Property Summary

NCBI Gene PubMed Count 237
PubMed Score 1130.53
PubTator Score 588.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Neoplasms, Germ Cell and Embryonal 15 0.0 0.0
Disease Target Count Z-score Confidence
Cancer 2499 5.826 2.9
Gonadoblastoma 34 3.275 1.6

Expression

Gene RIF (223)

AA Sequence

MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSST      1 - 70
SPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVK     71 - 140
TWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQT    141 - 210
QNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQT    211 - 280
TRYFSTPQTMDLFLNYSMNMQPEDV                                                 281 - 305
//

Text Mined References (237)

PMID Year Title