Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.600 0.000
medulloblastoma -1.400 0.000
adult high grade glioma -1.300 0.000
ductal carcinoma in situ 1.400 0.007
invasive ductal carcinoma 1.800 0.000

Synonym

Accession Q9H9R9 B4DQS3 Q69YT2 Q9BW25
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
19349376 TRIM32 is a widely expressed ubiquitin ligase and binds and ubiquitinates dysbindin.
19077176 Our results therefore support involvement of the dysbindin gene in cognitive function

AA Sequence

MEPPEGAGTGEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEV      1 - 70
HFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPE     71 - 140
RQATVLDTFLTVERPQED                                                        141 - 158
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19349376 2009 TRIM32 is an E3 ubiquitin ligase for dysbindin.
19340012 2009 Genome-wide association study of tanning phenotype in a population of European ancestry.
19077176 2009 Variation in the dysbindin gene and normal cognitive function in three independent population samples.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...