Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.300 2.1e-04
ductal carcinoma in situ 1.400 6.8e-03
ependymoma -1.600 9.5e-12
group 4 medulloblastoma -1.400 2.7e-05
invasive ductal carcinoma 1.800 2.6e-04

Synonym

Accession Q9H9R9 B4DQS3 Q69YT2 Q9BW25
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (2)

AA Sequence

MEPPEGAGTGEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEV      1 - 70
HFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPE     71 - 140
RQATVLDTFLTVERPQED                                                        141 - 158
//

Text Mined References (13)

PMID Year Title