Property Summary

NCBI Gene PubMed Count 61
PubMed Score 91.49
PubTator Score 40.19

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GWAS Trait (1)

Gene RIF (48)

AA Sequence

MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPA      1 - 70
AFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLM     71 - 140
GMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPF    141 - 210
VMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGP    211 - 280
LQRPQLSKVKRKKPRGLFS                                                       281 - 299
//

Text Mined References (64)

PMID Year Title