Property Summary

NCBI Gene PubMed Count 56
Grant Count 46
R01 Count 34
Funding $4,421,082.39
PubMed Score 79.80
PubTator Score 40.19

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (44)

PMID Text
27437582 using dual- and quadruple-trap optical tweezers combined with fluorescence microscopy, we show how human XRCC4, XLF and XRCC4-XLF complexes interact with DNA in real time
26100018 The data suggest that XLF has multiple functions in DNA repair, and they offer potential explanations for the pleiotropic phenotypes associated with XLF deficiency.
25661488 Phosphorylation of XLF impairs non-homologous end-joining DNA repair.
25321468 PC4 protects esophageal squamous cell carcinoma cells from IR-induced death by enhancing the nonhomologous end joining-promoting activity of XLF.
24626809 Werner syndrome protein positively regulates XRCC4-like factor transcription.
24461734 Human XLF is a non-essential, but critical, classic non-homologous end-joining -repair factor.
23818183 An induced pluripotent stem cell (iPSC) model of XLF deficiency, which accurately replicates the double-strand break repair deficiency observed in XLF syndrome patients, is reported.
23620595 Data indicate that Ku70/Ku80 facilitates the cooperative binding of multiple XRCC4/Ligase IV (XL) and XLF molecules to DNA.
23442139 XRCC4 and XLF form long helical protein filaments suitable for DNA end protection and alignment to facilitate DNA double strand break repair. (Review)
23207905 Cernunnos deficiency results in chronic activation of the DNA damage response, P53-driven upregulation of proapoptotic factors, leading to decreased thymocyte viability and a qualitative alteration of the T cell repertoire in both humans and mice.
More...

AA Sequence

MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPA      1 - 70
AFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLM     71 - 140
GMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPF    141 - 210
VMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGP    211 - 280
LQRPQLSKVKRKKPRGLFS                                                       281 - 299
//

Text Mined References (59)

PMID Year Title
27437582 2016 Sliding sleeves of XRCC4-XLF bridge DNA and connect fragments of broken DNA.
26100018 2015 XRCC4/XLF Interaction Is Variably Required for DNA Repair and Is Not Required for Ligase IV Stimulation.
25941166 2015 XLS (c9orf142) is a new component of mammalian DNA double-stranded break repair.
25670504 2015 Interactome analysis identifies a new paralogue of XRCC4 in non-homologous end joining DNA repair pathway.
25661488 2015 Akt-mediated phosphorylation of XLF impairs non-homologous end-joining DNA repair.
25574025 2015 DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25321468 2014 Inhibition of human positive cofactor 4 radiosensitizes human esophageal squmaous cell carcinoma cells by suppressing XLF-mediated nonhomologous end joining.
24626809 2014 Werner syndrome protein positively regulates XRCC4-like factor transcription.
24461734 2014 A role for XLF in DNA repair and recombination in human somatic cells.
More...