Property Summary

NCBI Gene PubMed Count 26
PubMed Score 60.71
PubTator Score 48.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer 1.203 1.4e-15
osteosarcoma 1.323 1.2e-03
ovarian cancer -1.600 2.7e-05

Protein-protein Interaction (8)

Gene RIF (18)

AA Sequence

MVPALRYLVGACGRARGLFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVGLASARALILR      1 - 70
HPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVA     71 - 140
VEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAG    141 - 210
GSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVP    211 - 280
FRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMD    281 - 350
IIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFV    351 - 420
FDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL                               421 - 463
//

Text Mined References (30)

PMID Year Title