Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.13
PubTator Score 8.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
22016508 Data indicate that chondrolectin (CHODL) is likely to be a prognostic biomarker in the clinic and targeting CHODL might be a strategy for the development of anticancer drugs.
17606388 CHODLDeltaE/CHODLfDeltaE protein variant localizes in the late endoplasmic reticulum and is detected in spleen and tonsils; the isoform seems to be differentially expressed in thymocytes and lymphocytes.
12621022 study describes the molecular characterization of novel members of the chondrolectin family associated with T cell maturation and a subcellular localization of chondrolectin f isoform in the endoplasmic reticulum-Golgi apparatus
12079284 cloning and characterization; localized at chromosome 21q21

AA Sequence

MSRVVSLLLGAALLCGHGAFCRRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLS      1 - 70
LENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCG     71 - 140
SEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTE    141 - 210
AGIIPNLIYVVIPTIPLLLLILVAFGTCCFQMLHKSKGRTKTSPNQSTLWISKSTRKESGMEV           211 - 273
//

Text Mined References (14)

PMID Year Title
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23568457 2013 Genetic variants associated with disordered eating.
22042635 2012 Antibody-based protein profiling of the human chromosome 21.
22016508 2011 Chondrolectin is a novel diagnostic biomarker and a therapeutic target for lung cancer.
17606388 2007 Expression and localization of CHODLDeltaE/CHODLfDeltaE, the soluble isoform of chondrolectin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12621022 2003 A novel alternative spliced chondrolectin isoform lacking the transmembrane domain is expressed during T cell maturation.
More...