Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.13
PubTator Score 8.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.800 1.9e-03
atypical teratoid / rhabdoid tumor 3.300 4.2e-04
cutaneous lupus erythematosus -1.200 8.6e-03
ependymoma 2.200 1.5e-05
glioblastoma 1.100 1.6e-02
group 3 medulloblastoma 2.800 1.0e-03
malignant mesothelioma 1.600 1.4e-04
medulloblastoma, large-cell 2.600 8.2e-03
ovarian cancer 1.800 2.0e-04
primitive neuroectodermal tumor 1.500 1.4e-02

 GO Function (1)

Gene RIF (4)

AA Sequence

MSRVVSLLLGAALLCGHGAFCRRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLS      1 - 70
LENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCG     71 - 140
SEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTE    141 - 210
AGIIPNLIYVVIPTIPLLLLILVAFGTCCFQMLHKSKGRTKTSPNQSTLWISKSTRKESGMEV           211 - 273
//

Text Mined References (14)

PMID Year Title