Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.76
PubTator Score 2.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma -1.200 0.020
psoriasis -1.700 0.000
osteosarcoma 2.149 0.000
ependymoma 1.100 0.001
ovarian cancer 2.100 0.000

AA Sequence

MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRL      1 - 70
PTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFTLRQVGII     71 - 140
CERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS                      141 - 192
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19200367 2009 Evolution of the multifaceted eukaryotic akirin gene family.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18066067 2008 Akirins are highly conserved nuclear proteins required for NF-kappaB-dependent gene expression in drosophila and mice.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...