Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.65
PubTator Score 3.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 3.400 0.000
osteosarcoma 2.634 0.000
glioblastoma 1.100 0.009
medulloblastoma, large-cell 1.100 0.001
lung cancer 1.700 0.000
group 3 medulloblastoma 1.300 0.001
ductal carcinoma in situ 1.100 0.001
invasive ductal carcinoma 1.300 0.000
ovarian cancer 1.600 0.006

Synonym

Accession Q9H9L3 D3DVC6 Q64KA2
Symbols HSD38

Gene

Gene RIF (2)

PMID Text
18976975 Knockdown of interferon stimulated exonuclease gene 20kDa-like 2 (ISG20L2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18065403 ISG20L2 is a 3' to 5' exoribonuclease involved in ribosome biogenesis at the level of 5.8 S rRNA maturation, more specifically in the processing of the 12 S precursor rRNA.

AA Sequence

MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGT      1 - 70
WKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKS     71 - 140
SQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDV    141 - 210
LYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLT    211 - 280
RDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNP    281 - 350
PTD                                                                       351 - 353
//

Text Mined References (13)

PMID Year Title
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22540864 2012 Proteomic characterization of the human FTSJ3 preribosomal complexes.
21269460 2011 Initial characterization of the human central proteome.
21036379 2011 Antiviral activities of ISG20 in positive-strand RNA virus infections.
19060904 2009 An empirical framework for binary interactome mapping.
18065403 2008 ISG20L2, a novel vertebrate nucleolar exoribonuclease involved in ribosome biogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...