Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
R01 Count 1
Funding $65,543.8
PubMed Score 2.54
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.200 0.040
psoriasis -3.300 0.000
osteosarcoma -4.134 0.000
pancreatic ductal adenocarcinoma liver m... -1.502 0.042
sonic hedgehog group medulloblastoma 1.200 0.001

Synonym

Accession Q9H9J2 Q53S16 Q6IA62 Q9H821 L44mt
Symbols L44MT
COXPD16
MRP-L44

Gene

 Grant Application (1)

PDB

3J9M   3J7Y  

Gene RIF (4)

PMID Text
25590838 MRPL44 expression may be a representative marker of metabolic phenotype according to OxPhos amount and a useful predictor of lymph node metastasis in Papillary thyroid carcinoma.
23315540 Decreased MRPL44 affected assembly of the large ribosomal subunit and stability of 16S rRNA leading to complex IV deficiency.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of mitochondrial ribosomal protein L44 (MRPL44) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHA      1 - 70
EIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQF     71 - 140
LEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPER    141 - 210
TALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKL    211 - 280
IAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS                      281 - 332
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25590838 2015 A metabolic phenotype based on mitochondrial ribosomal protein expression as a predictor of lymph node metastasis in papillary thyroid carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23315540 2013 Whole-exome sequencing identifies a mutation in the mitochondrial ribosome protein MRPL44 to underlie mitochondrial infantile cardiomyopathy.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...