Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.54
PubTator Score 3.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 16 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.200 4.0e-02
group 3 medulloblastoma 1.100 2.1e-02
osteosarcoma -4.134 1.0e-10
pancreatic ductal adenocarcinoma liver m... -1.502 4.2e-02
psoriasis -3.300 1.7e-05

Gene RIF (4)

AA Sequence

MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHA      1 - 70
EIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQF     71 - 140
LEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPER    141 - 210
TALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKL    211 - 280
IAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS                      281 - 332
//

Text Mined References (20)

PMID Year Title