Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1.82
PubTator Score 1.01

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (9)

AA Sequence

MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLK      1 - 70
ARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFID     71 - 140
VYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPP    141 - 210
PPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQP    211 - 280
GFILQ                                                                     281 - 285
//

Text Mined References (23)

PMID Year Title