Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.80
PubTator Score 1.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
chronic lymphosyte leukemia 232 2.261842906348E-7
adrenocortical carcinoma 1427 1.08365087417743E-6
sonic hedgehog group medulloblastoma 1482 7.42888993589837E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.54949646135979E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 5.65463199515995E-5
ovarian cancer 8492 1.70045525891003E-4
psoriasis 6685 3.82999347553281E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0026536777577853
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00441169618018732
Multiple myeloma 1328 0.0321611934616736

Expression

Synonym

Accession Q9H9H4 hVps37B
Symbols

Gene

  Ortholog (9)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (9)

PMID Text
23924735 VPS37B and appeared to interact with ALG-2 in a stronger manner than TSG101 does.
23895345 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
23305486 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
23027949 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
22004035 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
21762798 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18005716 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
15218037 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101

AA Sequence

MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLK      1 - 70
ARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFID     71 - 140
VYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPP    141 - 210
PPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQP    211 - 280
GFILQ                                                                     281 - 285
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23924735 2013 VPS37 isoforms differentially modulate the ternary complex formation of ALIX, ALG-2, and ESCRT-I.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22405001 2012 The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
22232651 2012 Structural basis for membrane targeting by the MVB12-associated ?-prism domain of the human ESCRT-I MVB12 subunit.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
More...