Property Summary

NCBI Gene PubMed Count 26
PubMed Score 14.41
PubTator Score 16.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.700 1.3e-02
atypical teratoid / rhabdoid tumor 1.600 9.3e-04
glioblastoma -1.200 3.5e-03
medulloblastoma, large-cell -1.400 4.9e-04
osteosarcoma 1.510 2.4e-06
pancreatic cancer 1.100 1.1e-03
pancreatic carcinoma 1.100 1.1e-03
Pick disease 2.100 1.0e-05
pituitary cancer -1.600 8.9e-04
psoriasis -1.100 1.6e-09
Rheumatoid arthritis 1.800 1.4e-02
tuberculosis and treatment for 6 months -1.100 1.7e-02

 IMPC Phenotype (1)

Gene RIF (10)

AA Sequence

MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSM      1 - 70
VQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRPFKVSIKFVSRVSWHLLHEVL     71 - 140
TGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPA    141 - 210
MWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKY    211 - 280
RVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAG    281 - 350
QRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVRSANYETDPFVQEFQFKVRDEMAHVTGRVLPAPMLQ    351 - 420
YGGRNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCREEILKGFTDQLRKISKDAGMPIQGQP    421 - 490
CFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVIKTSPQT    491 - 560
LSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATV    561 - 630
RVQRPRQEIIQDLASMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQ    631 - 700
PGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLW    701 - 770
DDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDP    771 - 840
QALAKAVQIHQDTLRTMYFA                                                      841 - 860
//

Text Mined References (31)

PMID Year Title