Property Summary

NCBI Gene PubMed Count 24
Grant Count 10
R01 Count 6
Funding $1,138,031
PubMed Score 12.70
PubTator Score 16.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.800 0.014
pancreatic cancer 1.100 0.001
astrocytic glioma 1.700 0.013
osteosarcoma 1.510 0.000
atypical teratoid / rhabdoid tumor 1.600 0.001
glioblastoma -1.200 0.003
medulloblastoma, large-cell -1.400 0.000
tuberculosis and treatment for 6 months -1.100 0.017
pancreatic carcinoma 1.100 0.001
psoriasis -1.100 0.000
Pick disease 2.100 0.000
pituitary cancer -1.600 0.001

 IMPC Term (1)

Gene RIF (9)

PMID Text
24100239 Study uncovers a first example of a vertebrate protein factor, Argonaute-3, specifically affecting the guide-to-passenger-strand ratio of the miRNA let-7a. A multi-layered mechanism for the observed impact of Ago3 on the let-7a-3p passenger strand expression and activity is proposed.
23748378 The Ago3 PIWI domain is slicing competent but our Ago3 model suggests multiple interactions between residues in the PIWI & N domains that may increase protein rigidity or invoke other properties that contribute to Ago3's observed slicing deficiency.
23665583 The N-terminal domain of Ago3 inhibits cleavage activity. AAs 1-64 are largely unstructured & form a large loop surrounding an area containing two helices & another unstructured loop.
23064648 DICER- and AGO3-dependent generation of retinoic acid-induced DR2 Alu RNAs regulates human stem cell proliferation.
22474261 Ago3 is able to load microRNAs efficiently in the absence of Ago1 and Ago2, despite a significant loss of global microRNA expression
21634124 reliable predictions of miRNA affinity to Ago2 AND Ago3 proteins were made.
19393748 EIF@C3 protein is expressed in both Schwann and neuron-type differentiating cells.
18771919 The specificity of RNA interference depends on the concentration of Ago1, Ago3, and Ago4 relative to Ago2.
18187620 Knockdown of eukaryotic translation initiation factor 2C, 3 (EIF2C3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSM      1 - 70
VQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRPFKVSIKFVSRVSWHLLHEVL     71 - 140
TGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPA    141 - 210
MWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKY    211 - 280
RVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAG    281 - 350
QRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVRSANYETDPFVQEFQFKVRDEMAHVTGRVLPAPMLQ    351 - 420
YGGRNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCREEILKGFTDQLRKISKDAGMPIQGQP    421 - 490
CFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVIKTSPQT    491 - 560
LSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATV    561 - 630
RVQRPRQEIIQDLASMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQ    631 - 700
PGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLW    701 - 770
DDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDP    771 - 840
QALAKAVQIHQDTLRTMYFA                                                      841 - 860
//

Text Mined References (29)

PMID Year Title
24100239 2013 Argonaute-3 activates the let-7a passenger strand microRNA.
23748378 2013 Molecular dissection of human Argonaute proteins by DNA shuffling.
23665583 2013 Turning catalytically inactive human Argonaute proteins into active slicer enzymes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23064648 2012 DICER- and AGO3-dependent generation of retinoic acid-induced DR2 Alu RNAs regulates human stem cell proliferation.
22915799 2012 HIV-1 replication and APOBEC3 antiviral activity are not regulated by P bodies.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22795694 2012 Slicing-independent RISC activation requires the argonaute PAZ domain.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...