Property Summary

NCBI Gene PubMed Count 24
PubMed Score 12.70
PubTator Score 16.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.62093825952407E-9
osteosarcoma 7933 2.44305793360306E-6
Pick disease 1893 1.01290459979451E-5
medulloblastoma, large-cell 6234 4.87287444848245E-4
pituitary cancer 1972 8.85427585885994E-4
atypical teratoid / rhabdoid tumor 4369 9.30159643300254E-4
pancreatic carcinoma 567 0.00111224603653342
pancreatic cancer 2300 0.00111224603653344
glioblastoma 5572 0.00346202096309568
astrocytic glioma 2241 0.012806934289793
Rheumatoid Arthritis 1171 0.0136722382925565
tuberculosis and treatment for 6 months 686 0.0174947504374295

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.800 0.014
pancreatic cancer 1.100 0.001
astrocytic glioma 1.700 0.013
osteosarcoma 1.510 0.000
atypical teratoid / rhabdoid tumor 1.600 0.001
glioblastoma -1.200 0.003
medulloblastoma, large-cell -1.400 0.000
tuberculosis and treatment for 6 months -1.100 0.017
pancreatic carcinoma 1.100 0.001
psoriasis -1.100 0.000
Pick disease 2.100 0.000
pituitary cancer -1.600 0.001

Synonym

Accession Q9H9G7 B1ALI0 Q5TA55 Q9H1U6 Argonaute3
Symbols EIF2C3

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG

 IMPC Term (1)

Gene RIF (9)

PMID Text
24100239 Study uncovers a first example of a vertebrate protein factor, Argonaute-3, specifically affecting the guide-to-passenger-strand ratio of the miRNA let-7a. A multi-layered mechanism for the observed impact of Ago3 on the let-7a-3p passenger strand expression and activity is proposed.
23748378 The Ago3 PIWI domain is slicing competent but our Ago3 model suggests multiple interactions between residues in the PIWI & N domains that may increase protein rigidity or invoke other properties that contribute to Ago3's observed slicing deficiency.
23665583 The N-terminal domain of Ago3 inhibits cleavage activity. AAs 1-64 are largely unstructured & form a large loop surrounding an area containing two helices & another unstructured loop.
23064648 DICER- and AGO3-dependent generation of retinoic acid-induced DR2 Alu RNAs regulates human stem cell proliferation.
22474261 Ago3 is able to load microRNAs efficiently in the absence of Ago1 and Ago2, despite a significant loss of global microRNA expression
21634124 reliable predictions of miRNA affinity to Ago2 AND Ago3 proteins were made.
19393748 EIF@C3 protein is expressed in both Schwann and neuron-type differentiating cells.
18771919 The specificity of RNA interference depends on the concentration of Ago1, Ago3, and Ago4 relative to Ago2.
18187620 Knockdown of eukaryotic translation initiation factor 2C, 3 (EIF2C3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSM      1 - 70
VQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRPFKVSIKFVSRVSWHLLHEVL     71 - 140
TGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPA    141 - 210
MWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKY    211 - 280
RVCNVTRRPASHQTFPLQLENGQTVERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAG    281 - 350
QRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVRSANYETDPFVQEFQFKVRDEMAHVTGRVLPAPMLQ    351 - 420
YGGRNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCREEILKGFTDQLRKISKDAGMPIQGQP    421 - 490
CFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVIKTSPQT    491 - 560
LSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATV    561 - 630
RVQRPRQEIIQDLASMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQ    631 - 700
PGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLW    701 - 770
DDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDP    771 - 840
QALAKAVQIHQDTLRTMYFA                                                      841 - 860
//

Text Mined References (29)

PMID Year Title
24100239 2013 Argonaute-3 activates the let-7a passenger strand microRNA.
23748378 2013 Molecular dissection of human Argonaute proteins by DNA shuffling.
23665583 2013 Turning catalytically inactive human Argonaute proteins into active slicer enzymes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23064648 2012 DICER- and AGO3-dependent generation of retinoic acid-induced DR2 Alu RNAs regulates human stem cell proliferation.
22915799 2012 HIV-1 replication and APOBEC3 antiviral activity are not regulated by P bodies.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22795694 2012 Slicing-independent RISC activation requires the argonaute PAZ domain.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...