Property Summary

NCBI Gene PubMed Count 14
Grant Count 6
R01 Count 6
Funding $776,916.17
PubMed Score 1.45
PubTator Score 5.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.700 0.000
group 3 medulloblastoma 1.100 0.003

Gene RIF (2)

PMID Text
24567363 Arp5 is a key regulator of Myocd activity.
19014934 Arp5 is involved in the process of DNA double strand break repair through the regulation of the chromatin remodelling machinery.

AA Sequence

MAANVFPFRDARAAPDPVLEAGPVAHGPLPVPLVLDNGSFQVRAGWACPGQDPGPEPRLQFRAVCARGRG      1 - 70
GARGASGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCN     71 - 140
PLYSRQMMSELLFECYGIPKVAYGIDSLFSFYHNKPKNSMCSGLIISSGYQCTHVLPILEGRLDAKNCKR    141 - 210
INLGGSQAAGYLQRLLQLKYPGHLAAITLSRMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPF    211 - 280
SSKLLGSTLTSEEKQERRQQQLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELN    281 - 350
MDSPEELQSYIQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEET    351 - 420
PGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDIQEMLVQN    421 - 490
VFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEK    491 - 560
GGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGGGGAGEQA                           561 - 607
//

Text Mined References (15)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24567363 2014 Arp5 is a key regulator of myocardin in smooth muscle cells.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
20855601 2010 INO80 chromatin remodeling complex promotes the removal of UV lesions by the nucleotide excision repair pathway.
19014934 2009 The human actin-related protein hArp5: nucleo-cytoplasmic shuttling and involvement in DNA repair.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
18163988 2008 The actin-related protein hArp8 accumulates on the mitotic chromosomes and functions in chromosome alignment.
18026119 2007 A YY1-INO80 complex regulates genomic stability through homologous recombination-based repair.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
More...