Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 5
Funding $269,098.87
PubMed Score 4.21
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 0.003
medulloblastoma, large-cell -1.200 0.015
Pick disease -1.100 0.002
ovarian cancer -2.000 0.000
Breast cancer -1.300 0.000

Synonym

Accession Q9H9E1
Symbols ANKRA

Gene

PANTHER Protein Class (1)

PDB

4LG6   3SO8   3V2O   3V2X   3V31   4QQI  

Gene RIF (1)

PMID Text
15964851 ANKRA, RFXANK, and CIITA are novel targets of class IIa HDACs which may deacetylases play a role in regulating MHCII expression

AA Sequence

MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVK      1 - 70
SLNEEDSKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIKQSTTLTNKHRGNE     71 - 140
VSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQL    141 - 210
LGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDS    211 - 280
GYNSMDLAVALGYRSVQQVIESHLLKLLQNIKE                                         281 - 313
//

Text Mined References (10)

PMID Year Title
25752541 2015 Ankyrin repeats of ANKRA2 recognize a PxLPxL motif on the 3M syndrome protein CCDC8.
25416956 2014 A proteome-scale map of the human interactome network.
22649097 2012 Sequence-specific recognition of a PxLPxI/L motif by an ankyrin repeat tumbler lock.
20873783 2010 Characterization of hNek6 interactome reveals an important role for its short N-terminal domain and colocalization with proteins at the centrosome.
15964851 2005 Identification of the ankyrin repeat proteins ANKRA and RFXANK as novel partners of class IIa histone deacetylases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11095640 2000 Characterization of ANKRA, a novel ankyrin repeat protein that interacts with the cytoplasmic domain of megalin.
10965114 2000 Assignment of ankyrin repeat, family A (RFXANK-like) 2 (ANKRA2) to human chromosome 5q12-->q13 by radiation hybrid mapping and somatic cell hybrid PCR.