Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.21
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.4e-08
Breast cancer 3578 1.9e-07
Pick disease 1894 1.7e-03
psoriasis 6694 3.2e-03
medulloblastoma, large-cell 6241 1.5e-02
Disease Target Count Z-score Confidence
Branchiooculofacial syndrome 13 5.13 2.6
3-M syndrome 15 4.816 2.4

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.300 1.9e-07
medulloblastoma, large-cell -1.200 1.5e-02
ovarian cancer -2.000 4.4e-08
Pick disease -1.100 1.7e-03
psoriasis 1.300 3.2e-03

Synonym

Accession Q9H9E1
Symbols ANKRA

Gene

PANTHER Protein Class (1)

PDB

4LG6   3SO8   3V2O   3V2X   3V31   4QQI  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVK      1 - 70
SLNEEDSKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIKQSTTLTNKHRGNE     71 - 140
VSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQL    141 - 210
LGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDS    211 - 280
GYNSMDLAVALGYRSVQQVIESHLLKLLQNIKE                                         281 - 313
//

Text Mined References (10)

PMID Year Title