Property Summary

NCBI Gene PubMed Count 19
Grant Count 5
R01 Count 5
Funding $1,108,595
PubMed Score 25.62
PubTator Score 18.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.331 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.005
ovarian cancer -1.200 0.000

Synonym

Accession Q9H9C1 B4DPI6 O95434 Q9H7E1 Q9H9I9 hSPE-39
Symbols SPE39
VIPAR
SPE-39
VPS16B
hSPE-39
C14orf133

Gene

Gene RIF (4)

PMID Text
23918659 Our data suggest that the ARC syndrome may result through impaired VIPAS39/SPE-39 and Vps33b-dependent endosomal maturation or fusion.
23002115 VPS16B, similar to its binding partner VPS33B, is essential for megakaryocyte and platelet alpha-granule biogenesis.
22677173 SPE-39 has an inhibitory effect due to tyrosine phosphorylation and ubiquitination on the function of Vps33B in the EGF-stimulated cells
19109425 SPE-39 homologues are present in RAB5-, RAB7-, and RAB11-positive endosomes where they play a conserved role in lysosomal delivery and probably function via their interaction with the core HOPS complex.

AA Sequence

MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWS      1 - 70
IRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPE     71 - 140
LGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSK    141 - 210
EILFRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDRTEELALSHYREHLNIQDPDKRKEFLKTCVGL    211 - 280
PFSAEDSAHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKHPRKASILNMPLVTTLFYSCFYHYTEAEG    281 - 350
TFSSPVNLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAPIGFHRVVEILHKNNAP    351 - 420
VQILQEYVNLVEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKIDALLSSSQIR    421 - 490
WKN                                                                       491 - 493
//

Text Mined References (24)

PMID Year Title
25783203 2015 Recruitment of VPS33A to HOPS by VPS16 Is Required for Lysosome Fusion with Endosomes and Autophagosomes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23918659 2013 Vps33b pathogenic mutations preferentially affect VIPAS39/SPE-39-positive endosomes.
23901104 2013 Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23002115 2012 The VPS33B-binding protein VPS16B is required in megakaryocyte and platelet ?-granule biogenesis.
22753090 2012 Associations among genotype, clinical phenotype, and intracellular localization of trafficking proteins in ARC syndrome.
22677173 2012 Inhibitory effect of SPE-39 due to tyrosine phosphorylation and ubiquitination on the function of Vps33B in the EGF-stimulated cells.
21350494 2011 On the endosomal function and gene nomenclature of human SPE-39.
20578233 2010 Design and validation of a metabolic disorder resequencing microarray (BRUM1).
More...