Property Summary

NCBI Gene PubMed Count 22
PubMed Score 27.17
PubTator Score 18.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.200 5.0e-03
osteosarcoma 1.331 4.4e-06
ovarian cancer -1.200 2.6e-08

Gene RIF (5)

AA Sequence

MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWS      1 - 70
IRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPE     71 - 140
LGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSK    141 - 210
EILFRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDRTEELALSHYREHLNIQDPDKRKEFLKTCVGL    211 - 280
PFSAEDSAHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKHPRKASILNMPLVTTLFYSCFYHYTEAEG    281 - 350
TFSSPVNLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAPIGFHRVVEILHKNNAP    351 - 420
VQILQEYVNLVEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKIDALLSSSQIR    421 - 490
WKN                                                                       491 - 493
//

Text Mined References (27)

PMID Year Title