Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.73
PubTator Score 12.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.089 6.4e-03
adult high grade glioma -1.600 2.5e-04
astrocytic glioma 1.400 5.2e-03
atypical teratoid / rhabdoid tumor -1.400 3.3e-05
ependymoma 1.300 1.5e-02
glioblastoma -1.400 1.4e-03
intraductal papillary-mucinous adenoma (... 1.200 2.0e-03
intraductal papillary-mucinous carcinoma... 1.600 9.1e-04
intraductal papillary-mucinous neoplasm ... 2.100 8.8e-04
lung adenocarcinoma 1.300 2.3e-10
lung cancer 1.700 4.7e-05
lung carcinoma 1.500 2.4e-27
medulloblastoma -1.300 3.5e-04
medulloblastoma, large-cell -2.000 6.3e-06
non primary Sjogren syndrome sicca -1.100 1.8e-02
non-small cell lung cancer 1.506 1.9e-21
oligodendroglioma 1.600 6.5e-03
osteosarcoma -2.564 5.2e-07
pancreatic ductal adenocarcinoma liver m... -1.505 8.5e-03
primitive neuroectodermal tumor 1.200 4.9e-04
psoriasis -2.300 1.4e-04
spina bifida -1.398 4.2e-02
ulcerative colitis -1.100 9.6e-07

Gene RIF (2)

AA Sequence

MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWR      1 - 70
AKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDA     71 - 140
PLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDE    141 - 210
NGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFAT    211 - 280
PLCCALFPQKSSMSVTSLEAELQAKIQESHPELRRVYFNKGL                                281 - 322
//

Text Mined References (27)

PMID Year Title