Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.73
PubTator Score 12.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.39760590630864E-27
non-small cell lung cancer 2798 1.85460745829879E-21
lung adenocarcinoma 2714 2.33631062192285E-10
ependymoma 2514 3.45271079751417E-7
osteosarcoma 7933 5.2115269490301E-7
ulcerative colitis 2087 9.61476548169814E-7
medulloblastoma, large-cell 6234 6.28539751163514E-6
atypical teratoid / rhabdoid tumor 4369 3.25027578467241E-5
lung cancer 4473 4.70526393192544E-5
psoriasis 6685 1.38729072001296E-4
adult high grade glioma 2148 2.48500069721585E-4
medulloblastoma 1524 3.52619189459784E-4
primitive neuroectodermal tumor 3031 4.92494538659196E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.83011926567899E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.10337566922618E-4
glioblastoma 5572 0.0014000913961439
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00204694379585285
astrocytic glioma 2241 0.00523610912357363
adrenocortical carcinoma 1427 0.00644733091553244
oligodendroglioma 2849 0.00650156155689216
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00850337812893791
non primary Sjogren syndrome sicca 840 0.0182086229620062
spina bifida 1064 0.0376229155897601
Disease Target Count Z-score Confidence
Aceruloplasminemia 17 4.215 2.1

Expression

Synonym

Accession Q9H9B4 B3KPW3 D3DQN2 Q9HA53
Symbols TCC

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify sideroflexin 1 (SFXN1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWR      1 - 70
AKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDA     71 - 140
PLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDE    141 - 210
NGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFAT    211 - 280
PLCCALFPQKSSMSVTSLEAELQAKIQESHPELRRVYFNKGL                                281 - 322
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
More...