Property Summary

NCBI Gene PubMed Count 30
Grant Count 124
R01 Count 46
Funding $17,629,962.54
PubMed Score 41.16
PubTator Score 34.73

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H9A7 Q05BX1 Q05CW3 Q5SQG8 Q5SQG9 Q6P1Q4 Q6PI89 Q7Z6L6
Symbols BLAP75
FAAP75
C9orf76

Gene

PDB

4CGY   4CHT   4DAY   3MXN   3NBH   3NBI  

 GO Function (1)

 GO Component (2)

Gene RIF (20)

PMID Text
26717309 a model that maps all functionally important structural features for yeast Rmi1 and structure-prediction-based alignment with the recently established crystal structure of the N-terminus of human Rmi1, is proposed.
26556339 RMI1 protein level does not change through G1, S and G2 phases, but significantly increases in M phase.
25200081 The results show that Topo IIIalpha stimulates DNA unwinding by BLM in a manner that is potentiated by RMI1-RMI2, and that the processivity of resection is reliant on the Topo IIIalpha-RMI1-RMI2 complex.
24108125 two proteins that interact with BLM, RMI1 and RMI2, are phosphorylated upon SAC activation, and, like BLM, RMI1, and RMI2, are phosphorylated in an MPS1-dependent manner.
22645306 RMI1 is required to promote normal replication fork progression
22082156 Knockdown of RMI1 by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20826342 Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex
20445207 human topoisomerase IIIalpha functions as a decatenase with the assistance of BLM and RMI1 to facilitate the processing of homologous recombination intermediates without crossing over as a mechanism to preserve genome integrity
19945966 No evidence was found for an association between RMI1 S455N (rs1982151) and colorectal cancer risk.
19945966 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLP      1 - 70
DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLT     71 - 140
DGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARL    141 - 210
IGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPT    211 - 280
RQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIE    281 - 350
RFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKN    351 - 420
LETDNKIKQTSSSDSHSLNNKILNREVVNYVQKRNSQISNENDCNLQSCSLRSSENSINLSIAMDLYSPP    421 - 490
FVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPE    491 - 560
MKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK         561 - 625
//

Text Mined References (36)

PMID Year Title
26717309 2015 Structural Motifs Critical for In Vivo Function and Stability of the RecQ-Mediated Genome Instability Protein Rmi1.
26556339 2015 Accumulation and Phosphorylation of RecQ-Mediated Genome Instability Protein 1 (RMI1) at Serine 284 and Serine 292 during Mitosis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25200081 2014 Multifaceted role of the Topo III?-RMI1-RMI2 complex and DNA2 in the BLM-dependent pathway of DNA break end resection.
24108125 2013 Monopolar spindle 1 (MPS1) protein-dependent phosphorylation of RecQ-mediated genome instability protein 2 (RMI2) at serine 112 is essential for BLM-Topo III ?-RMI1-RMI2 (BTR) protein complex function upon spindle assembly checkpoint (SAC) activation during mitosis.
23918034 2014 Genome-wide association study (GWAS) for molar-incisor hypomineralization (MIH).
23509288 2013 Scaffolding protein SPIDR/KIAA0146 connects the Bloom syndrome helicase with homologous recombination repair.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...