Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.69
PubTator Score 1.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.443 0.001
group 3 medulloblastoma 1.300 0.000

Gene

Gene RIF (2)

PMID Text
23303381 Human CNOT10 and CNOT11 form a complex that interacts with the CNOT1 N-terminal domain.
23232451 CNOT11 interacts with the first amino acids of CNOT1 and with CNOT10 and is required for the association of CNOT10 with the CCR4-NOT complex.

AA Sequence

MAADKPADQGAEKHEGTGQSSGITDQEKELSTNAFQAFTSGNYDACLQHLACLQDINKDDYKIILNTAVA      1 - 70
EFFKSNQTTTDNLRQTLNQLKNQVHSAVEEMDGLDDVENSMLYYNQAVILYHLRQYTEAISVGEKLYQFI     71 - 140
EPFEEKFAQAVCFLLVDLYILTYQAEKALHLLAVLEKMISQGNNNKNGKNETGNNNNKDGSNHKAESGAL    141 - 210
IEAAKSKIHQYKVRAYIQMKSLKACKREIKSVMNTAGNSAPSLFLKSNFEYLRGNYRKAVKLLNSSNIAE    211 - 280
HPGFMKTGECLRCMFWNNLGCIHFAMSKHNLGIFYFKKALQENDNVCAQLSAGSTDPGKKFSGRPMCTLL    281 - 350
TNKRYELLYNCGIQLLHIGRPLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGI    351 - 420
VQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPVASMEFAAICLRNALLLLPEEQQDPKQENGAKNSNQ    421 - 490
LGGNTESSESSETCSSKSHDGDKFIPAPPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLL    491 - 560
QQPKLSGSLKFLGHLYAAEALISLDRISDAITHLNPENVTDVSLGISSNEQDQGSDKGENEAMESSGKRA    561 - 630
PQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAILLAVYLELQNGNTQLAL    631 - 700
QIIKRNQLLPAVKTHSEVRKKPVFQPVHPIQPIQMPAFTTVQRK                              701 - 744
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23303381 2013 NOT10 and C2orf29/NOT11 form a conserved module of the CCR4-NOT complex that docks onto the NOT1 N-terminal domain.
23232451 2013 C2ORF29/CNOT11 and CNOT10 form a new module of the CCR4-NOT complex.
23221646 2013 Trypanosome CNOT10 is essential for the integrity of the NOT deadenylase complex and for degradation of many mRNAs.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...