Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.69
PubTator Score 1.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
group 3 medulloblastoma 4104 6.9e-06
osteosarcoma 7950 5.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 1.1
Disease Target Count Z-score Confidence
Amenorrhea 58 3.73 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.300 6.9e-06
osteosarcoma -1.443 5.2e-04

Gene RIF (2)

AA Sequence

MAADKPADQGAEKHEGTGQSSGITDQEKELSTNAFQAFTSGNYDACLQHLACLQDINKDDYKIILNTAVA      1 - 70
EFFKSNQTTTDNLRQTLNQLKNQVHSAVEEMDGLDDVENSMLYYNQAVILYHLRQYTEAISVGEKLYQFI     71 - 140
EPFEEKFAQAVCFLLVDLYILTYQAEKALHLLAVLEKMISQGNNNKNGKNETGNNNNKDGSNHKAESGAL    141 - 210
IEAAKSKIHQYKVRAYIQMKSLKACKREIKSVMNTAGNSAPSLFLKSNFEYLRGNYRKAVKLLNSSNIAE    211 - 280
HPGFMKTGECLRCMFWNNLGCIHFAMSKHNLGIFYFKKALQENDNVCAQLSAGSTDPGKKFSGRPMCTLL    281 - 350
TNKRYELLYNCGIQLLHIGRPLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGI    351 - 420
VQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPVASMEFAAICLRNALLLLPEEQQDPKQENGAKNSNQ    421 - 490
LGGNTESSESSETCSSKSHDGDKFIPAPPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLL    491 - 560
QQPKLSGSLKFLGHLYAAEALISLDRISDAITHLNPENVTDVSLGISSNEQDQGSDKGENEAMESSGKRA    561 - 630
PQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAILLAVYLELQNGNTQLAL    631 - 700
QIIKRNQLLPAVKTHSEVRKKPVFQPVHPIQPIQMPAFTTVQRK                              701 - 744
//

Text Mined References (23)

PMID Year Title