Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.31
PubTator Score 2.82

Knowledge Summary

Patent (664)

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.144 0.008
psoriasis 1.100 0.001
ulcerative colitis -1.400 0.000
hereditary spastic paraplegia -1.221 0.003
acute quadriplegic myopathy 1.255 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.008
lung cancer 1.100 0.014
dermatomyositis 1.200 0.001

Synonym

Accession Q9H999 D3DQL1 Q53FJ9 Q7RTX4 hPanK3
Symbols

Gene

PANTHER Protein Class (2)

PDB

2I7P   3MK6   3SMS   5KPR   5KPT   5KPZ   5KQ8   5KQD  

 Collection (1)

Gene RIF (2)

PMID Text
18976975 Knockdown of pantothenate kinase 3 (PANK3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17631502 analysis of the homodimeric structures of the catalytic cores of PanK1alpha and PanK3 in complex with acetyl-CoA and the the structural effects of the PanK2 mutations that have been implicated in neurodegeneration

AA Sequence

MKIKDAKKPSFPWFGMDIGGTLVKLSYFEPIDITAEEEQEEVESLKSIRKYLTSNVAYGSTGIRDVHLEL      1 - 70
KDLTLFGRRGNLHFIRFPTQDLPTFIQMGRDKNFSTLQTVLCATGGGAYKFEKDFRTIGNLHLHKLDELD     71 - 140
CLVKGLLYIDSVSFNGQAECYYFANASEPERCQKMPFNLDDPYPLLVVNIGSGVSILAVHSKDNYKRVTG    141 - 210
TSLGGGTFLGLCSLLTGCESFEEALEMASKGDSTQADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEK    211 - 280
RESVSKEDLARATLVTITNNIGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALF    281 - 350
LEHEGYFGAVGALLGLPNFS                                                      351 - 370
//

Text Mined References (10)

PMID Year Title
20797618 2010 Modulation of pantothenate kinase 3 activity by small molecules that interact with the substrate/allosteric regulatory domain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17631502 2007 Crystal structures of human pantothenate kinases. Insights into allosteric regulation and mutations linked to a neurodegeneration disorder.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11479594 2001 A novel pantothenate kinase gene (PANK2) is defective in Hallervorden-Spatz syndrome.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2981478 1985 Coenzyme A metabolism.
1695905 1990 Human facilitative glucose transporters. Isolation, functional characterization, and gene localization of cDNAs encoding an isoform (GLUT5) expressed in small intestine, kidney, muscle, and adipose tissue and an unusual glucose transporter pseudogene-like sequence (GLUT6).