Property Summary

NCBI Gene PubMed Count 14
PubMed Score 952.00
PubTator Score 82.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma 1.400 8.0e-03
lung adenocarcinoma 1.052 7.6e-04
Multiple myeloma 1.303 4.5e-03
osteosarcoma 1.474 1.3e-04
ovarian cancer 1.200 9.2e-04
spina bifida -1.123 4.6e-02
Waldenstrons macroglobulinemia 1.217 1.4e-02

Gene RIF (4)

AA Sequence

MESKPSRIPRRISVQPSSSLSARMMSGSRGSSLNDTYHSRDSSFRLDSEYQSTSASASASPFQSAWYSES      1 - 70
EITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFGTDLM     71 - 140
RERRDLERRTDSSISNLMDYSHRSGDFTTSSYVQDRVPSYSQGARPKENSMSTLQLNTSSTNHQLPSEHQ    141 - 210
TILSSRDSRNSLRSNFSSRESESSRSNTQPGFSYSSSRDEAPIISNSERVVSSQRPFQESSDNEGRRTTR    211 - 280
RLLSRIASSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVPDNRASEASQGFRF    281 - 350
LRRRWGLSSLSHNHSSESDSENFNQESEGRNTGPWLSSSLRNRCTPLFSRRRREGRDESSRIPTSDTSSR    351 - 420
SHIFRRESNEVVHLEAQNDPLGAAANRPQASAASSSATTGGSTSDSAQGGRNTGISGILPGSLFRFAVPP    421 - 490
ALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIKESLLLEDSEEEEGDLCRICQMAAA    491 - 560
SSSNLLIEPCKCTGSLQYVHQDCMKKWLQAKINSGSSLEAVTTCELCKEKLELNLEDFDIHELHRAHANE    561 - 630
QAEYEFISSGLYLVVLLHLCEQSFSDMMGNTNEPSTRVRFINLARTLQAHMEDLETSEDDSEEDGDHNRT    631 - 700
FDIA                                                                      701 - 704
//

Text Mined References (18)

PMID Year Title