Property Summary

NCBI Gene PubMed Count 13
Grant Count 118
R01 Count 81
Funding $11,820,036.09
PubMed Score 931.36
PubTator Score 82.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.217 0.014
Multiple myeloma 1.303 0.005
osteosarcoma 1.474 0.000
group 4 medulloblastoma 1.400 0.008
lung adenocarcinoma 1.052 0.001
spina bifida -1.123 0.046
ovarian cancer 1.200 0.001

Synonym

Accession Q9H992 A8K9X1 B7Z7P5 D3DPB0 Q53GQ1 Q9BTR9
Symbols AXO
AXOT
RNF177
MARCH-VII

Gene

Gene RIF (3)

PMID Text
19901269 Axotrophin/MARCH-7 has an expression profile that is distinct from that of other MARCH family members.
18410486 MARCH7 can be stabilized by both USP9X and USP7, which deubiquitylate MARCH7 in the cytosol and nucleus, respectively
17161353 Data suggest that clinical auto-graft versus host disease inversely correlates with axotrophin transcript expression.

AA Sequence

MESKPSRIPRRISVQPSSSLSARMMSGSRGSSLNDTYHSRDSSFRLDSEYQSTSASASASPFQSAWYSES      1 - 70
EITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFGTDLM     71 - 140
RERRDLERRTDSSISNLMDYSHRSGDFTTSSYVQDRVPSYSQGARPKENSMSTLQLNTSSTNHQLPSEHQ    141 - 210
TILSSRDSRNSLRSNFSSRESESSRSNTQPGFSYSSSRDEAPIISNSERVVSSQRPFQESSDNEGRRTTR    211 - 280
RLLSRIASSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVPDNRASEASQGFRF    281 - 350
LRRRWGLSSLSHNHSSESDSENFNQESEGRNTGPWLSSSLRNRCTPLFSRRRREGRDESSRIPTSDTSSR    351 - 420
SHIFRRESNEVVHLEAQNDPLGAAANRPQASAASSSATTGGSTSDSAQGGRNTGISGILPGSLFRFAVPP    421 - 490
ALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIKESLLLEDSEEEEGDLCRICQMAAA    491 - 560
SSSNLLIEPCKCTGSLQYVHQDCMKKWLQAKINSGSSLEAVTTCELCKEKLELNLEDFDIHELHRAHANE    561 - 630
QAEYEFISSGLYLVVLLHLCEQSFSDMMGNTNEPSTRVRFINLARTLQAHMEDLETSEDDSEEDGDHNRT    631 - 700
FDIA                                                                      701 - 704
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19901269 2010 The E3 ligase axotrophin/MARCH-7: protein expression profiling of human tissues reveals links to adult stem cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18410486 2008 The ubiquitin E3 ligase MARCH7 is differentially regulated by the deubiquitylating enzymes USP7 and USP9X.
17161353 2006 Evidence for functional inter-relationships between FOXP3, leukaemia inhibitory factor, and axotrophin/MARCH-7 in transplantation tolerance.
16868077 2006 E2-25K mediates US11-triggered retro-translocation of MHC class I heavy chains in a permeabilized cell system.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...