Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.23
PubTator Score 0.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 1.88390471623804E-8
medulloblastoma, large-cell 6234 1.70309707090464E-4
atypical teratoid / rhabdoid tumor 4369 0.00411504482185298
osteosarcoma 7933 0.0209982621608835
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 2.0
Disease Target Count Z-score Confidence
Atrial Fibrillation 110 3.757 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -3.700 0.000
osteosarcoma 1.125 0.021
atypical teratoid / rhabdoid tumor 1.100 0.004
medulloblastoma, large-cell 1.800 0.000

Synonym

Accession Q9H987 A5PKV9 Q68A20
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGAEEEVLVTLSGGAPWGFRLHGGAEQRKPLQVSKIRRRSQAGRAGLRERDQLLAINGVSCTNLSHASAM      1 - 70
SLIDASGNQLVLTVQRLADEGPVQSPSPHELQVLSPLSPLSPEPPGAPVPQPLQPGSLRSPPDSEAYYGE     71 - 140
TDSDADGPATQEKPRRPRRRGPTRPTPPGAPPDEVYLSDSPAEPAPTIPGPPSQGDSRVSSPSWEDGAAL    141 - 210
QPPPAEALLLPHGPLRPGPHLIPMVGPVPHPVAEDLTTTYTQKAKQAKLQRAESLQEKSIKEAKTKCRTI    211 - 280
ASLLTAAPNPHSKGVLMFKKRRQRAKKYTLVSFGAAAGTGAEEEDGVPPTSESELDEEAFSDARSLTNQS    281 - 350
DWDSPYLDMELARAGSRASEGQGSGLGGQLSEVSGRGVQLFEQQRQRADSSTQELARVEPAAMLNGEGLQ    351 - 420
SPPRAQSAPPEAAVLPPSPLPAPVASPRPFQPGGGAPTPAPSIFNRSARPFTPGLQGQRPTTTSVIFRPL    421 - 490
APKRANDSLGGLSPAPPPFLSSQGPTPLPSFTSGVPSHAPVSGSPSTPRSSGPVTATSSLYIPAPSRPVT    491 - 560
PGGAPEPPAPPSAAAMTSTASIFLSAPLRPSARPEAPAPGPGAPEPPSAREQRISVPAARTGILQEARRR    561 - 630
GTRKQMFRPGKEETKNSPNPELLSLVQNLDEKPRAGGAESGPEEDALSLGAEACNFMQPVGARSYKTLPH    631 - 700
VTPKTPPPMAPKTPPPMTPKTPPPVAPKPPSRGLLDGLVNGAASSAGIPEPPRLQGRGGELFAKRQSRAD    701 - 770
RYVVEGTPGPGLGPRPRSPSPTPSLPPSWKYSPNIRAPPPIAYNPLLSPFFPQAARTLPKAQSQGPRATP    771 - 840
KQGIKALDFMRHQPYQLKTAMFCFDEVPPTPGPIASGSPKTARVQEIRRFSTPAPQPTAEPLAPTVLAPR    841 - 910
AATTLDEPIWRTELASAPVPSPAPPPEAPRGLGASPSSCGFQVARPRFSATRTGLQAHVWRPGAGHQ       911 - 977
//

Text Mined References (8)

PMID Year Title
22544366 2012 Meta-analysis identifies six new susceptibility loci for atrial fibrillation.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.