Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease 1.234 3.3e-02
active ulcerative colitis 1.020 9.8e-03
adrenocortical carcinoma 1.275 7.4e-03
ependymoma 1.300 1.5e-07
nasopharyngeal carcinoma -1.200 1.3e-03
ovarian cancer -1.300 2.6e-03

AA Sequence

MFRWERSIPLRGSAAALCNNLSVLQLPARNLTYFGVVHGPSAQLLSAAPEGVPLAQRQLHAKEGAGVSPP      1 - 70
LITQVHWCVLPFRVLLVLTSHRGIQMYESNGYTMVYWHALDSGDASPVQAVFARGIAASGHFICVGTWSG     71 - 140
RVLVFDIPAKGPNIVLSEELAGHQMPITDIATEPAQGQDCVADMVTADDSGLLCVWRSGPEFTLLTRIPG    141 - 210
FGVPCPSVQLWQGIIAAGYGNGQVHLYEATTGNLHVQINAHARAICALDLASEVGKLLSAGEDTFVHIWK    211 - 280
LSRNPESGYIEVEHCHGECVADTQLCGARFCDSSGNSFAVTGYDLAEIRRFSSV                    281 - 334
//

Text Mined References (6)

PMID Year Title