Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.00
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.072 0.004
glioblastoma 1.200 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.100 0.000
primitive neuroectodermal tumor 1.100 0.000
lung cancer 1.600 0.000
pediatric high grade glioma 1.200 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
ovarian cancer 1.100 0.004

Synonym

Accession Q9H974 A6NGE9 B7Z472 B7Z5R2 J3KR78 Q6IA59
Symbols QTRTD1

Gene

Gene RIF (2)

PMID Text
21044367 Observational study of gene-disease association. (HuGE Navigator)
20354154 TGT is composed of a catalytic subunit, QTRT1, and QTRTD1, not USP14. QTRTD1 has been implicated as the salvage enzyme that generates free queuine from QMP.

AA Sequence

MKLSLTKVVNGCRLGKIKNLGKTGDHTMDIPGCLLYTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEH      1 - 70
HEVLTEYKEGVGKFIGMPESLLYCSLHDPVSPCPAGYVTNKSVSVWSVAGRVEMTVSKFMAIQKALQPDW     71 - 140
FQCLSDGEVSCKEATSIKRVRKSVDRSLLFLDNCLRLQEESEVLQKSVIIGVIEGGDVMEERLRSARETA    141 - 210
KRPVGGFLLDGFQGNPTTLEARLRLLSSVTAELPEDKPRLISGVSRPDEVLECIERGVDLFESFFPYQVT    211 - 280
ERGCALTFSFDYQPNPEETLLQQNGTQEEIKCMDQIKKIETTGCNQEITSFEINLKEKKYQEDFNPLVRG    281 - 350
CSCYCCKNHTRAYIHHLLVTNELLAGVLLMMHNFEHYFGFFHYIREALKSDKLAQLKELIHRQAS         351 - 415
//

Text Mined References (11)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
21131277 2011 Evolution of eukaryal tRNA-guanine transglycosylase: insight gained from the heterocyclic substrate recognition by the wild-type and mutant human and Escherichia coli tRNA-guanine transglycosylases.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20354154 2010 Characterization of the human tRNA-guanine transglycosylase: confirmation of the heterodimeric subunit structure.
19414587 2009 Queuosine formation in eukaryotic tRNA occurs via a mitochondria-localized heteromeric transglycosylase.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...