Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.00
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 3.9e-03
glioblastoma 1.200 1.3e-06
lung cancer 1.600 1.5e-04
medulloblastoma, large-cell 1.100 1.4e-04
osteosarcoma -1.072 3.7e-03
ovarian cancer 1.100 3.9e-03
pediatric high grade glioma 1.200 1.6e-05
primitive neuroectodermal tumor 1.100 2.1e-04
sonic hedgehog group medulloblastoma 1.400 1.1e-05

Gene RIF (2)

AA Sequence

MKLSLTKVVNGCRLGKIKNLGKTGDHTMDIPGCLLYTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEH      1 - 70
HEVLTEYKEGVGKFIGMPESLLYCSLHDPVSPCPAGYVTNKSVSVWSVAGRVEMTVSKFMAIQKALQPDW     71 - 140
FQCLSDGEVSCKEATSIKRVRKSVDRSLLFLDNCLRLQEESEVLQKSVIIGVIEGGDVMEERLRSARETA    141 - 210
KRPVGGFLLDGFQGNPTTLEARLRLLSSVTAELPEDKPRLISGVSRPDEVLECIERGVDLFESFFPYQVT    211 - 280
ERGCALTFSFDYQPNPEETLLQQNGTQEEIKCMDQIKKIETTGCNQEITSFEINLKEKKYQEDFNPLVRG    281 - 350
CSCYCCKNHTRAYIHHLLVTNELLAGVLLMMHNFEHYFGFFHYIREALKSDKLAQLKELIHRQAS         351 - 415
//

Text Mined References (11)

PMID Year Title