Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.43
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.2e-06
cutaneous lupus erythematosus -1.100 1.3e-03
ependymoma 1.300 5.6e-10
group 3 medulloblastoma 2.400 2.0e-07
medulloblastoma, large-cell 1.900 5.7e-06
osteosarcoma -2.207 4.1e-09
primitive neuroectodermal tumor 1.600 4.9e-05

Gene RIF (1)

AA Sequence

MSFSATILFSPPSGSEARCCCCACKSETNGGNTGSQGGNPPPSTPITVTGHGLAVQSSEQLLHVIYQRVD      1 - 70
KAVGLAEAALGLARANNELLKRLQEEVGDLRQGKVSIPDEDGESRAHSSPPEEPGPLKESPGEAFKALSA     71 - 140
VEEECDSVGSGVQVVIEELRQLGAASVGPGPLGFPATQRDMRLPGCTLAASEAAPLLNPLVDDYVASEGA    141 - 210
VQRVLVPAYAKQLSPATQLAIQRATPETGPENGTKLPPPRPEDMLNAAAALDSALEESGPGSTGELRHSL    211 - 280
GLTVSPCRTRGSGQKNSRRKRDLVLSKLVHNVHNHITNDKRFNGSESIKSSWNISVVKFLLEKLKQELVT    281 - 350
SPHNYTDKELKGACVAYFLTKRREYRNSLNPFKGLKEKEEKKLRSRRYRLFANRSSIMRHFGPEDQRLWN    351 - 420
DVTEELMSDEEDSLNEPGVWVARPPRFRAQRLTELCYHLDANSKHGTKANRVYGPPSDRLPSAEAQLLPP    421 - 490
ELYNPNFQEEEDEGGDENAPGSPSFDQPHKTCCPDLNSFIEIKVEKDE                          491 - 538
//

Text Mined References (14)

PMID Year Title