Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 7.00921672917651E-7
pilocytic astrocytoma 3086 0.00356689996014503
glioblastoma 5572 0.0112802534917418
subependymal giant cell astrocytoma 2287 0.0122647011063289
non primary Sjogren syndrome sicca 840 0.0198079912606337
astrocytic glioma 2241 0.0270952709546746
adult high grade glioma 2148 0.0311977568765515

AA Sequence

MREKSFQCNESGKAFNCSSLLKKCQIIHLGEKKYKCDICGKVFNQKRYLAYHHRCHTGEKPYKCNQCGKT      1 - 70
FSYKSSLVIHKAIHTGEKPHKCNECGKVFNQKAYLASHHRLHTGEKPYKCEECDKVFSR                71 - 129
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.