Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.400 3.1e-02
astrocytic glioma -1.700 2.7e-02
Astrocytoma, Pilocytic -1.400 3.8e-03
ependymoma -1.600 5.4e-08
glioblastoma -1.300 1.1e-02
non primary Sjogren syndrome sicca -1.100 2.0e-02
subependymal giant cell astrocytoma -2.011 1.2e-02

AA Sequence

MREKSFQCNESGKAFNCSSLLKKCQIIHLGEKKYKCDICGKVFNQKRYLAYHHRCHTGEKPYKCNQCGKT      1 - 70
FSYKSSLVIHKAIHTGEKPHKCNECGKVFNQKAYLASHHRLHTGEKPYKCEECDKVFSR                71 - 129
//

Text Mined References (5)

PMID Year Title