Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.53
PubTator Score 12.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
hepatocellular carcinoma 1.300 5.5e-05
lung cancer 1.400 2.3e-03
osteosarcoma 1.404 1.4e-03
tuberculosis and treatment for 6 months -1.100 7.2e-05

Gene RIF (3)

AA Sequence

MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSE      1 - 70
YPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISV     71 - 140
EVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAG    141 - 210
IR                                                                        211 - 212
//

Text Mined References (18)

PMID Year Title