Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
R01 Count 2
Funding $447,818
PubMed Score 3.60
PubTator Score 12.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
hepatocellular carcinoma 1.300 0.000
osteosarcoma 1.404 0.001
tuberculosis and treatment for 6 months -1.100 0.000
lung cancer 1.800 0.001

Synonym

Accession Q9H944 B4DE08 O95821 Q5T8J4 Q9Y429
Symbols TRFP
PRO0213

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (2)

PMID Text
25446406 We identified the first and homozygous mutation (p.Gly114Ala) in the Mediator subunit 20 gene (MED20) in siblings presenting with infantile-onset spasticity and childhood-onset dystonia, progressive basal ganglia degeneration, and brain atrophy
18976975 Knockdown of mediator complex subunit 20 (MED20) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSE      1 - 70
YPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISV     71 - 140
EVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAG    141 - 210
IR                                                                        211 - 212
//

Text Mined References (17)

PMID Year Title
25446406 2015 MED20 mutation associated with infantile basal ganglia degeneration and brain atrophy.
25416956 2014 A proteome-scale map of the human interactome network.
24101134 2013 Gene expression profile of the whole Mediator complex in human osteosarcoma and normal osteoblasts.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
21269460 2011 Initial characterization of the human central proteome.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
More...