Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.36
PubTator Score 5.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy -1.056 3.1e-03
atypical teratoid / rhabdoid tumor 1.300 4.4e-04
group 3 medulloblastoma 1.600 1.0e-03
lung cancer 1.500 2.4e-03
lung carcinoma -2.200 3.5e-24
malignant mesothelioma -5.100 3.3e-09
osteosarcoma -5.283 2.2e-09
psoriasis -1.500 3.5e-04

Gene RIF (2)

AA Sequence

MTRSLFKGNFWSADILSTIGYDNIIQHLNNGRKNCKEFEDFLKERAAIEERYGKDLLNLSRKKPCGQSEI      1 - 70
NTLKRALEVFKQQVDNVAQCHIQLAQSLREEARKMEEFREKQKLQRKKTELIMDAIHKQKSLQFKKTMDA     71 - 140
KKNYEQKCRDKDEAEQAVSRSANLVNPKQQEKLFVKLATSKTAVEDSDKAYMLHIGTLDKVREEWQSEHI    141 - 210
KACEAFEAQECERINFFRNALWLHVNQLSQQCVTSDEMYEQVRKSLEMCSIQRDIEYFVNQRKTGQIPPA    211 - 280
PIMYENFYSSQKNAVPAGKATGPNLARRGPLPIPKSSPDDPNYSLVDDYSLLYQ                    281 - 334
//

Text Mined References (14)

PMID Year Title