Property Summary

NCBI Gene PubMed Count 12
Grant Count 26
R01 Count 11
Funding $1,800,524.14
PubMed Score 10.19
PubTator Score 5.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -5.100 0.000
psoriasis -1.500 0.000
osteosarcoma -5.283 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
acute quadriplegic myopathy -1.056 0.003
lung cancer 1.500 0.002
group 3 medulloblastoma 1.600 0.001
lung carcinoma -2.200 0.000

Gene RIF (2)

PMID Text
24407241 PSTPIP2 dysregulation contributes to aberrant terminal differentiation in GATA-1-deficient megakaryocytes by activating LYN.
20032092 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTRSLFKGNFWSADILSTIGYDNIIQHLNNGRKNCKEFEDFLKERAAIEERYGKDLLNLSRKKPCGQSEI      1 - 70
NTLKRALEVFKQQVDNVAQCHIQLAQSLREEARKMEEFREKQKLQRKKTELIMDAIHKQKSLQFKKTMDA     71 - 140
KKNYEQKCRDKDEAEQAVSRSANLVNPKQQEKLFVKLATSKTAVEDSDKAYMLHIGTLDKVREEWQSEHI    141 - 210
KACEAFEAQECERINFFRNALWLHVNQLSQQCVTSDEMYEQVRKSLEMCSIQRDIEYFVNQRKTGQIPPA    211 - 280
PIMYENFYSSQKNAVPAGKATGPNLARRGPLPIPKSSPDDPNYSLVDDYSLLYQ                    281 - 334
//

Text Mined References (14)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24407241 2014 PSTPIP2 dysregulation contributes to aberrant terminal differentiation in GATA-1-deficient megakaryocytes by activating LYN.
21269460 2011 Initial characterization of the human central proteome.
20032092 2010 Genetic susceptibility factors in a cohort of 38 patients with SAPHO syndrome: a study of PSTPIP2, NOD2, and LPIN2 genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...