Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.17
PubTator Score 1.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H920 B3KSW8 Q6IA57 Q6P449 Q96DB4
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
26602861 Over-expression of RNF121 promoted ubiquitination of VEGFR-2, inhibited its maturation . RNF121 knockdown in primary endothelial cells reduced VEGFR-2 ubiquitination and increased its cell surface level.
25388546 These results unveil an unexpected role of Golgi Apparatus and reveal RNF121 as a new player involved in the signaling leading to NF-kappaB activation.
24928685 This is the first study to demonstrate that RNF121 is a novel regulator of apoptosis and provides a new potential target for cancer therapy

AA Sequence

MAAVVEVEVGGGAAGERELDEVDMSDLSPEEQWRVEHARMHAKHRGHEAMHAEMVLILIATLVVAQLLLV      1 - 70
QWKQRHPRSYNMVTLFQMWVVPLYFTVKLHWWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFL     71 - 140
LIYKISYATGIVGYMAVMFTLFGLNLLFKIKPEDAMDFGISLLFYGLYYGVLERDFAEMCADYMASTIGF    141 - 210
YSESGMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVD    211 - 280
LKRMFSNPWERPHVMYGQLLDWLRYLVAWQPVIIGVVQGINYILGLE                           281 - 327
//

Text Mined References (11)

PMID Year Title
26602861 2016 RNF121 Inhibits Angiogenic Growth Factor Signaling by Restricting Cell Surface Expression of VEGFR-2.
25388546 2014 The E3 ubiquitin ligase RNF121 is a positive regulator of NF-?B activation.
24928685 2014 Really interesting new gene finger protein 121 is a novel Golgi-localized membrane protein that regulates apoptosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...