Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.37
PubTator Score 1.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Oral Submucous Fibrosis 20 3.709 1.9

Expression

Gene RIF (3)

AA Sequence

MAAVVEVEVGGGAAGERELDEVDMSDLSPEEQWRVEHARMHAKHRGHEAMHAEMVLILIATLVVAQLLLV      1 - 70
QWKQRHPRSYNMVTLFQMWVVPLYFTVKLHWWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFL     71 - 140
LIYKISYATGIVGYMAVMFTLFGLNLLFKIKPEDAMDFGISLLFYGLYYGVLERDFAEMCADYMASTIGF    141 - 210
YSESGMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVD    211 - 280
LKRMFSNPWERPHVMYGQLLDWLRYLVAWQPVIIGVVQGINYILGLE                           281 - 327
//

Text Mined References (11)

PMID Year Title