Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.57
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 2.3e-08
Breast cancer 3.100 2.7e-02
breast carcinoma 1.100 1.0e-28
ductal carcinoma in situ 1.100 2.2e-03
ependymoma 1.200 8.2e-08
glioblastoma 1.100 7.8e-05
group 3 medulloblastoma 2.000 2.5e-04
interstitial cystitis -1.100 1.7e-05
invasive ductal carcinoma 1.600 8.8e-05
lung adenocarcinoma 1.200 6.5e-08
lung cancer 2.300 9.8e-04
medulloblastoma, large-cell 1.900 4.5e-04
non-small cell lung cancer 1.340 3.6e-26
osteosarcoma -2.581 5.1e-10
ovarian cancer 1.900 3.9e-04
primitive neuroectodermal tumor 1.900 2.0e-04
psoriasis -3.100 9.6e-06
tuberculosis and treatment for 6 months -1.200 3.2e-04

Synonym

Accession Q9H910 B1AJY2 B4DLH4 Q6EIC7
Symbols L11
HN1L
C16orf34

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSG      1 - 70
IFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPG     71 - 140
EKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY                        141 - 190
//

Text Mined References (23)

PMID Year Title