Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 1.04714493620375E-28
non-small cell lung cancer 2798 3.61785265255397E-26
osteosarcoma 7933 5.05231933699188E-10
posterior fossa group A ependymoma 1511 3.86989505120983E-9
atypical teratoid / rhabdoid tumor 4369 7.95047845561231E-9
lung adenocarcinoma 2714 3.85016834600748E-8
psoriasis 6685 9.58160627874975E-6
interstitial cystitis 2299 1.73396940517997E-5
invasive ductal carcinoma 2950 8.79693284013753E-5
primitive neuroectodermal tumor 3031 2.04463606618834E-4
group 3 medulloblastoma 2254 2.51990255131843E-4
tuberculosis and treatment for 6 months 686 3.18997982487799E-4
ovarian cancer 8492 3.87963063783313E-4
medulloblastoma, large-cell 6234 4.53874868463482E-4
lung cancer 4473 9.77830832221545E-4
glioblastoma 5572 0.00118632725142598
ductal carcinoma in situ 1745 0.00223467081233694
Breast cancer 3099 0.0270162221104319

Expression

  Differential Expression (18)

Synonym

Accession Q9H910 B1AJY2 B4DLH4 Q6EIC7 HN1-like protein
Symbols L11
C16orf34

Gene

Gene RIF (1)

PMID Text
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSG      1 - 70
IFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPG     71 - 140
EKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY                        141 - 190
//

Text Mined References (22)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
More...