Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.32
PubTator Score 3.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 1.976 5.8e-05
Alzheimer's disease -1.100 4.7e-02
astrocytic glioma -1.300 7.5e-03
atypical teratoid / rhabdoid tumor 1.500 1.6e-05
Breast cancer 3.300 2.7e-02
breast carcinoma 1.100 6.7e-28
ductal carcinoma in situ 1.200 8.5e-05
ependymoma -1.100 3.4e-02
glioblastoma 1.700 1.1e-04
group 3 medulloblastoma 1.600 4.0e-03
intraductal papillary-mucinous carcinoma... 1.100 6.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.8e-02
invasive ductal carcinoma 1.500 8.4e-04
lung cancer 1.700 5.0e-03
medulloblastoma, large-cell 2.500 3.0e-05
nasopharyngeal carcinoma 1.200 3.5e-04
non-small cell lung cancer 1.858 3.2e-17
oligodendroglioma -1.300 7.7e-03
osteosarcoma 2.539 4.3e-04
ovarian cancer 2.300 7.7e-05
pediatric high grade glioma 1.500 1.0e-04
Pick disease -1.600 2.6e-05
primitive neuroectodermal tumor 1.800 1.0e-04
psoriasis 1.400 3.7e-08
tuberculosis and treatment for 3 months -1.100 4.9e-04
ulcerative colitis 1.100 6.9e-05

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MWERLNCAAEDFYSRLLQKFNEEKKGIRKDPFLYEADVQVQLISKGQPNPLKNILNENDIVFIVEKVPLE      1 - 70
KEETSHIEELQSEETAISDFSTGENVGPLALPVGKARQLIGLYTMAHNPNMTHLKINLPVTALPPLWVRC     71 - 140
DSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFK    141 - 210
SSALDDTITASQTAIALDISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLADGLR    211 - 280
TGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAE    281 - 350
QLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQML    351 - 420
LEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFS    421 - 490
LTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFH    491 - 560
KPDFSELTLNGSLEERIFFTNMVTCSQVHFK                                           561 - 591
//

Text Mined References (14)

PMID Year Title