Property Summary

NCBI Gene PubMed Count 32
PubMed Score 24.65
PubTator Score 23.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.700 8.0e-03
dermatomyositis 1.100 1.4e-03
glioblastoma 1.300 2.6e-02
lung cancer 1.200 2.3e-03
Multiple myeloma 1.272 9.9e-04
non primary Sjogren syndrome sicca 1.200 4.0e-02
osteosarcoma 1.023 7.8e-04
ovarian cancer 4.100 1.5e-07

Protein-protein Interaction (8)

Gene RIF (12)

AA Sequence

MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKML      1 - 70
IYSSKTLELRETSVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGAD     71 - 140
TVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPFEEG    141 - 210
KKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGVPTVP    211 - 280
LLPPQVNQSLTSVPPMNPATTLPGLMPLPAGLPNLPNLNLNLPAPHIMPGVGLPELVNPGLPPLPSMPPR    281 - 350
NLPGIAPLPLPSEFLPSFPLVPESSSAASSGELLSSLPPTSNAPSDPATTTAKADAASSLTVDVTPPTAK    351 - 420
APTTVEDRVGDSTPVSEKPVSAAVDANASESP                                          421 - 452
//

Text Mined References (49)

PMID Year Title