Tbio | Golgi reassembly-stacking protein 2 |
Plays a role in the assembly and membrane stacking of the Golgi cisternae, and in the process by which Golgi stacks reform after mitotic breakdown. May regulate the intracellular transport and presentation of a defined set of transmembrane proteins, such as transmembrane TGFA.
This gene encodes a member of the Golgi reassembly stacking protein family. These proteins may play a role in the stacking of Golgi cisternae and Golgi ribbon formation, as well as Golgi fragmentation during apoptosis or mitosis. The encoded protein also plays a role in the intracellular transport of transforming growth factor alpha and may function as a molecular chaperone. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
This gene encodes a member of the Golgi reassembly stacking protein family. These proteins may play a role in the stacking of Golgi cisternae and Golgi ribbon formation, as well as Golgi fragmentation during apoptosis or mitosis. The encoded protein also plays a role in the intracellular transport of transforming growth factor alpha and may function as a molecular chaperone. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
Comments
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 1.45006722276021E-7 |
Multiple myeloma | 1328 | 7.65431447746511E-4 |
osteosarcoma | 7933 | 7.79284785952554E-4 |
dermatomyositis | 967 | 0.00144342231370871 |
lung cancer | 4473 | 0.00234473911168812 |
astrocytoma | 1493 | 0.00801203309491876 |
glioblastoma | 5572 | 0.0260582734400616 |
non primary Sjogren syndrome sicca | 840 | 0.0399326138975571 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Exudative vitreoretinopathy | 15 | 3.233 | 1.6 |
Disease | log2 FC | p |
---|---|---|
Multiple myeloma | 1.423 | 0.001 |
osteosarcoma | 1.023 | 0.001 |
astrocytoma | 1.700 | 0.008 |
glioblastoma | 1.300 | 0.026 |
lung cancer | 1.200 | 0.002 |
non primary Sjogren syndrome sicca | 1.200 | 0.040 |
ovarian cancer | 4.100 | 0.000 |
dermatomyositis | 1.100 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
25701785 | GRASP55 interacts with CD83 shortly after induction of dendritic cells maturation. |
24227884 | Cisternal-specific functions of GRASP65 and GRASP55 in continuity, compartmentalization, and function of the Golgi ribbon. |
23552074 | propose that GRASP55/65 are negative regulators of exocytic transport and that this slowdown helps to ensure more complete protein glycosylation in the Golgi stack and proper sorting at the trans-Golgi network |
20608975 | GRASP55 may function as an adaptor protein coupling MT1-MMP with furin, thus leading to the activation of the zymogen. |
20083603 | These results demonstrate that GRASP55 and GRASP65 stack mammalian Golgi cisternae via a common mechanism. |
19840934 | Data demonstrate that both GRASP55 and 65 are needed for the efficient transport to and through the Golgi complex, thus highlighting a novel role for the GRASPs in membrane trafficking. |
18976975 | Knockdown of golgi reassembly stacking protein 2 (GORASP2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells |
18434598 | MEK1/ERK regulation of GRASP55-mediated Golgi linking is a control point in cell cycle progression |
11815631 | GRASP65 is an important structural component required for maintenance of Golgi apparatus integrity |
11739401 | GRASP55 forms an effector complex for the small GTPase rab2, together with a conserved coiled-coil protein golgin-45 (JEM-1). |
MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKML 1 - 70 IYSSKTLELRETSVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGAD 71 - 140 TVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPFEEG 141 - 210 KKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGVPTVP 211 - 280 LLPPQVNQSLTSVPPMNPATTLPGLMPLPAGLPNLPNLNLNLPAPHIMPGVGLPELVNPGLPPLPSMPPR 281 - 350 NLPGIAPLPLPSEFLPSFPLVPESSSAASSGELLSSLPPTSNAPSDPATTTAKADAASSLTVDVTPPTAK 351 - 420 APTTVEDRVGDSTPVSEKPVSAAVDANASESP 421 - 452 //
PMID | Year | Title |
---|---|---|
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25807930 | 2015 | Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development. |
25701785 | 2015 | CD83 and GRASP55 interact in human dendritic cells. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
25255805 | 2014 | Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
24227884 | 2014 | Isoform-specific tethering links the Golgi ribbon to maintain compartmentalization. |
24136289 | 2013 | Identification and comparative analysis of hepatitis C virus-host cell protein interactions. |
23552074 | 2013 | Regulation of protein glycosylation and sorting by the Golgi matrix proteins GRASP55/65. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
More... |