Property Summary

NCBI Gene PubMed Count 29
Grant Count 30
R01 Count 23
Funding $1,348,314.14
PubMed Score 22.34
PubTator Score 23.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.423 0.001
osteosarcoma 1.023 0.001
astrocytoma 1.700 0.008
glioblastoma 1.300 0.026
lung cancer 1.200 0.002
non primary Sjogren syndrome sicca 1.200 0.040
ovarian cancer 4.100 0.000
dermatomyositis 1.100 0.001

Gene RIF (10)

PMID Text
25701785 GRASP55 interacts with CD83 shortly after induction of dendritic cells maturation.
24227884 Cisternal-specific functions of GRASP65 and GRASP55 in continuity, compartmentalization, and function of the Golgi ribbon.
23552074 propose that GRASP55/65 are negative regulators of exocytic transport and that this slowdown helps to ensure more complete protein glycosylation in the Golgi stack and proper sorting at the trans-Golgi network
20608975 GRASP55 may function as an adaptor protein coupling MT1-MMP with furin, thus leading to the activation of the zymogen.
20083603 These results demonstrate that GRASP55 and GRASP65 stack mammalian Golgi cisternae via a common mechanism.
19840934 Data demonstrate that both GRASP55 and 65 are needed for the efficient transport to and through the Golgi complex, thus highlighting a novel role for the GRASPs in membrane trafficking.
18976975 Knockdown of golgi reassembly stacking protein 2 (GORASP2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18434598 MEK1/ERK regulation of GRASP55-mediated Golgi linking is a control point in cell cycle progression
11815631 GRASP65 is an important structural component required for maintenance of Golgi apparatus integrity
11739401 GRASP55 forms an effector complex for the small GTPase rab2, together with a conserved coiled-coil protein golgin-45 (JEM-1).

AA Sequence

MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKML      1 - 70
IYSSKTLELRETSVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGAD     71 - 140
TVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPFEEG    141 - 210
KKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGVPTVP    211 - 280
LLPPQVNQSLTSVPPMNPATTLPGLMPLPAGLPNLPNLNLNLPAPHIMPGVGLPELVNPGLPPLPSMPPR    281 - 350
NLPGIAPLPLPSEFLPSFPLVPESSSAASSGELLSSLPPTSNAPSDPATTTAKADAASSLTVDVTPPTAK    351 - 420
APTTVEDRVGDSTPVSEKPVSAAVDANASESP                                          421 - 452
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25701785 2015 CD83 and GRASP55 interact in human dendritic cells.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24227884 2014 Isoform-specific tethering links the Golgi ribbon to maintain compartmentalization.
24136289 2013 Identification and comparative analysis of hepatitis C virus-host cell protein interactions.
23552074 2013 Regulation of protein glycosylation and sorting by the Golgi matrix proteins GRASP55/65.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...