Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.18
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.3e-05
psoriasis 6694 2.9e-04
lung cancer 4740 1.9e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 3.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.100 1.9e-03
osteosarcoma -1.778 1.3e-05
pancreatic ductal adenocarcinoma liver m... 1.129 3.2e-03
psoriasis -1.400 2.9e-04

Gene RIF (1)

AA Sequence

MSPAPDAAPAPASISLFDLSADAPVFQGLSLVSHAPGEALARAPRTSCSGSGERESPERKLLQGPMDISE      1 - 70
KLFCSTCDQTFQNHQEQREHYKLDWHRFNLKQRLKDKPLLSALDFEKQSSTGDLSSISGSEDSDSASEED     71 - 140
LQTLDRERATFEKLSRPPGFYPHRVLFQNAQGQFLYAYRCVLGPHQDPPEEAELLLQNLQSRGPRDCVVL    141 - 210
MAAAGHFAGAIFQGREVVTHKTFHRYTVRAKRGTAQGLRDARGGPSHSAGANLRRYNEATLYKDVRDLLA    211 - 280
GPSWAKALEEAGTILLRAPRSGRSLFFGGKGAPLQRGDPRLWDIPLATRRPTFQELQRVLHKLTTLHVYE    281 - 350
EDPREAVRLHSPQTHWKTVREERKKPTEEEIRKICRDEKEALGQNEESPKQGSGSEGEDGFQVELELVEL    351 - 420
TVGTLDLCESEVLPKRRRRKRNKKEKSRDQEAGAHRTLLQQTQEEEPSTQSSQAVAAPLGPLLDEAKAPG    421 - 490
QPELWNALLAACRAGDVGVLKLQLAPSPADPRVLSLLSAPLGSGGFTLLHAAAAAGRGSVVRLLLEAGAD    491 - 560
PTVQDSRARPPYTVAADKSTRNEFRRFMEKNPDAYDYNKAQVPGPLTPEMEARQATRKREQKAARRQREE    561 - 630
QQQRQQEQEEREREEQRRFAALSDREKRALAAERRLAAQLGAPTSPIPDSAIVNTRRCWSCGASLQGLTP    631 - 700
FHYLDFSFCSTRCLQDHRRQAGRPSS                                                701 - 726
//

Text Mined References (19)

PMID Year Title