Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.48
PubTator Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia -1.600 1.2e-02
adult high grade glioma -1.200 9.8e-05
Astrocytoma, Pilocytic -1.200 4.4e-08
atypical teratoid / rhabdoid tumor -1.300 9.0e-07
glioblastoma -1.200 6.2e-05
group 3 medulloblastoma -1.300 1.7e-04
lung adenocarcinoma -1.200 4.9e-02
medulloblastoma, large-cell -1.500 1.2e-04
psoriasis -1.600 4.2e-30

Gene RIF (4)

AA Sequence

MDTRSGSQCSVTPEAILNNEKLVLPPRISRVNGWSLPLHYFQVVTWAVFVGLSSATFGIFIPFLPHAWKY      1 - 70
IAYVVTGGIFSFHLVVHLIASCIDPADSNVRLMKNYSQPMPLFDRSKHAHVIQNQFCHLCKVTVNKKTKH     71 - 140
CISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAGMLCLIAILLYVLVQYLVNPGVLRTDPRYED    141 - 210
VKNMNTWLLFLPLFPVQVQTLIVVIIGMLVLLLDFLGLVHLGQLLIFHIYLKAKKMTTFEYLINNRKEES    211 - 280
SKHQAVRKDPYVQMDKGVLQQGAGALGSSAQGVKAKSSLLIHKHLCHFCTSVNQDGDSTAREGDEDPCPS    281 - 350
ALGAKARNSRLICRRLCQFSTRVHPDGGSMAQEADDAPSISTLGLQQETTEPMKTDSAESED            351 - 412
//

Text Mined References (11)

PMID Year Title