Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.9e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.301 3.9e-06

Synonym

Accession Q9H8X3 Q495C5
Symbols C6orf208
dJ182D15.1

 Compartment GO Term (0)

AA Sequence

MSLCSACTSPASHQLLLNCQGQTVAKSHSSADAGVSLVSGRWCAWWPEHCSESMFPSQHPVLSSNLADSS      1 - 70
GQGRSPAGAHPALCPFHKSPWFPHFPQILPREWSWCGPERPAGCSLGLKAEAALVGKK                 71 - 128
//

Text Mined References (5)

PMID Year Title