Property Summary

NCBI Gene PubMed Count 12
PubMed Score 18.63
PubTator Score 12.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.1e-05
breast carcinoma 1637 3.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Pneumocystosis 17 3.157 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.400 3.8e-04
osteosarcoma -1.224 3.1e-05

Synonym

Accession Q9H8X2 Q5T9F7 Q9H7V8
Symbols IP5K
IPK1
C9orf12
INSP5K2
bA476B13.1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MEEGKMDENEWGYHGEGNKSLVVAHAQRCVVLRFLKFPPNRKKTSEEIFQHLQNIVDFGKNVMKEFLGEN      1 - 70
YVHYGEVVQLPLEFVKQLCLKIQSERPESRCDKDLDTLSGYAMCLPNLTRLQTYRFAEHRPILCVEIKPK     71 - 140
CGFIPFSSDVTHEMKHKVCRYCMHQHLKVATGKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKI    141 - 210
FKNGELIYGCKDARSPVADWSELAHHLKPFFFPSNGLASGPHCTRAVIRELVHVITRVLLSGSDKGRAGT    211 - 280
LSPGLGPQGPRVCEASPFSRSLRCQGKNTPERSGLPKGCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLE    281 - 350
EFPEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQDASSDQ    351 - 420
RPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKESEDCTLVLHK    421 - 490
V//

Text Mined References (13)

PMID Year Title