Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.66
PubTator Score 5.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
pancreatic cancer -1.100 0.000
Waldenstrons macroglobulinemia -1.573 0.022
posterior fossa group B ependymoma 2.000 0.000
astrocytoma 1.100 0.000
glioblastoma 1.300 0.000
osteosarcoma 1.303 0.000
group 4 medulloblastoma 1.500 0.001
medulloblastoma, large-cell 1.400 0.031
sarcoidosis 1.300 0.014
breast carcinoma 1.300 0.000
Breast cancer 4.000 0.049
pediatric high grade glioma 1.300 0.000
pilocytic astrocytoma 1.600 0.000
primary Sjogren syndrome 1.200 0.003
pancreatic carcinoma -1.100 0.000
ductal carcinoma in situ 1.600 0.001
invasive ductal carcinoma 2.700 0.001
ovarian cancer 1.200 0.001

Synonym

Accession Q9H8W4 PH domain-containing family F member 2
Symbols EAPF
PHAFIN2
ZFYVE18

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
24416124 These findings establish that lysosomal accumulation of Akt and Phafin2 is a critical step in the induction of autophagy via an interaction with phosphatidylinositol 3 phosphate.
22816767 Phafin2 controls EGFR trafficking through early endosomes by facilitating endosome fusion in concert with EEA1.
19995552 These results provide a vivid example that an endosome modulator, such as Phafin2, may control the cells' responses to the extracellular cues.
18288467 Results demonstrate that EAPF/Phafin-2 facilitates TNF-alpha-induced cellular apoptosis through an ER-mitochondrial apoptotic pathway.

AA Sequence

MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQ      1 - 70
KKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKT     71 - 140
PSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDL    141 - 210
LSAGDMATCQPARSDSYSQSLKSPLNDMSDDDDDDDSSD                                   211 - 249
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24416124 2014 Lysosomal interaction of Akt with Phafin2: a critical step in the induction of autophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22816767 2012 The PtdIns3P-binding protein Phafin 2 mediates epidermal growth factor receptor degradation by promoting endosome fusion.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
More...