Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 4.2e-16
osteosarcoma 7950 1.1e-03
group 3 medulloblastoma 4104 1.4e-02
lung cancer 4740 2.5e-02
astrocytic glioma 2597 2.6e-02
oligodendroglioma 2850 3.1e-02
ependymoma 4679 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 2.6e-02
ependymoma -1.600 4.6e-02
group 3 medulloblastoma 1.100 1.4e-02
lung adenocarcinoma -1.500 4.2e-16
lung cancer 1.100 2.5e-02
oligodendroglioma -1.500 3.1e-02
osteosarcoma -1.245 1.1e-03

Gene RIF (2)

AA Sequence

MWSGLLPPGLNESDAESNSEDEATLENSGLNLQEDKEDESIRKTEIIDFSTDEPKTETESNVNAYEECPS      1 - 70
GIPIDMWNKFQELHKKHSEQKSTTSRFRGKRRKRSRKDKLKNEKELHSEPSSNETQWKELTQYFGVNDRF     71 - 140
DPPVKRKKVEKSGLEKRIDQAVEEWNIEKAEELSNQLATRELGVKIAKAVACHNFVKAKKEVENSQAARK    141 - 210
KKKLAWGFEAKKRWETKSNMGYM                                                   211 - 233
//

Text Mined References (9)

PMID Year Title