Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.600 2.0e-05
lung adenocarcinoma -1.500 3.7e-10
lung cancer -3.200 1.7e-03
lung carcinoma -2.700 2.0e-20
malignant mesothelioma 1.900 6.9e-07
non-small cell lung carcinoma -2.400 4.2e-37

Synonym

Accession Q9H8W2 E1P533 Q5TG13
Symbols C6orf155

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MRPGSSPRAPECGAPALPRPQLDRLPARPAPSRGRGAPSLRWPAKEVGPRPQIPATCEPGKVCGASAGRR      1 - 70
DAARPSRPRSSRVTFSTRRQPGPQRGRWGLRGGPESVRGLPHLGLRISGTPLGIFSSWSL               71 - 130
//

Text Mined References (8)

PMID Year Title