Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
lung cancer -3.200 0.002
lung adenocarcinoma -2.000 0.000
lung carcinoma -2.700 0.000
non-small cell lung carcinoma -2.400 0.000
Breast cancer -1.600 0.000

Synonym

Accession Q9H8W2 E1P533 Q5TG13
Symbols C6orf155

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
26564482 LINC00472 is functionally a tumor suppressor.LINC00472 expression is regulated by promoter methylation and associated with disease-free survival in patients with grade 2 breast cancer.
25865225 Patients with high LINC00472 had significantly reduced risk of relapse and death, and they also had more favorable subtypes and better responses to adjuvant chemo- or hormonal therapy.

AA Sequence

MRPGSSPRAPECGAPALPRPQLDRLPARPAPSRGRGAPSLRWPAKEVGPRPQIPATCEPGKVCGASAGRR      1 - 70
DAARPSRPRSSRVTFSTRRQPGPQRGRWGLRGGPESVRGLPHLGLRISGTPLGIFSSWSL               71 - 130
//

Text Mined References (6)

PMID Year Title
26564482 2015 LINC00472 expression is regulated by promoter methylation and associated with disease-free survival in patients with grade 2 breast cancer.
25865225 2015 Prognostic and predictive values of long non-coding RNA LINC00472 in breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.