Knowledge Summary

Patent

No data available

Synonym

Accession Q9H8V8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MKPDWPRRGAAGTRVRSRGEGDGTYFARRGAGRRRREIKAPIRAAWSPPSAAMSGLQSGRRWRPQGTGTG      1 - 70
ARAAGALAALRLGPRLRAAPLLAPLWLLAPTPDSHMTPAPLALRASRGWRENNLSDYQYSWMQKC          71 - 135
//

Text Mined References (1)

PMID Year Title