Property Summary

NCBI Gene PubMed Count 70
PubMed Score 74.00
PubTator Score 88.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
esophageal adenocarcinoma 1.800 2.0e-02
psoriasis 1.300 9.5e-63
glioblastoma 1.800 6.8e-07
sonic hedgehog group medulloblastoma 2.400 4.2e-05
atypical teratoid/rhabdoid tumor 2.100 7.3e-06
medulloblastoma, large-cell 1.500 1.5e-04
primitive neuroectodermal tumor 1.500 2.4e-03
Atopic dermatitis 1.500 9.8e-05
adrenocortical carcinoma 2.438 4.1e-05
tuberculosis 1.100 4.6e-03
non-small cell lung cancer 3.089 1.8e-30
intraductal papillary-mucinous adenoma (... 3.000 1.0e-03
intraductal papillary-mucinous carcinoma... 4.000 1.6e-04
intraductal papillary-mucinous neoplasm ... 4.300 1.5e-03
colon cancer 2.300 1.5e-02
lung cancer 4.100 1.4e-05
active Crohn's disease 1.485 1.1e-02
pancreatic cancer 2.600 7.5e-08
breast carcinoma 2.000 1.2e-39
Breast cancer 3.200 2.5e-02
lung adenocarcinoma 1.699 9.8e-05
pediatric high grade glioma 1.700 4.4e-04
nasopharyngeal carcinoma 1.700 3.1e-04
Endometriosis 1.018 4.9e-02
ductal carcinoma in situ 2.300 1.1e-03
invasive ductal carcinoma 2.300 3.7e-04
ulcerative colitis 1.300 1.8e-05
ovarian cancer 2.700 1.4e-04

 GWAS Trait (1)

Gene RIF (48)

PMID Text
26211594 Colorectal cancer patients with high expression levels of ECT2 had shorter overall survival.
25674238 Up-regulation of ECT2 might contribute to the progression of gastric carcinogenesis and may be a useful prognostic indicator in gastric cancer.
25617497 ECT2 can crosstalk with RACGAP1 to catalyse the GTP exchange involved in Rho signalling to further regulate tumour initiation and metastasis.
25486482 central spindle assembly and 2 Plk1-dependent phosphorylations are required to establish efficient binding of the Ect2 BRCT in early cytokinesis.
25486481 Poly(ADP-ribosyl)ation is recognized by ECT2.
25237947 ECT2 expression is positively correlated with WHO pathologic grading and unfavorable survival, suggesting that ECT2 may be a potential therapeutic candidate in human gliomas.
25068414 structure of triple-BRCT-domain of ECT2 and insights into the binding characteristics to CYK-4
24784921 the deregulation of miR-223 and its target gene ECT2 may be associated with the aggressive tumor progression of human osteosarcoma
24484057 Abnormality of the ECT2 gene occurs at a relatively early stage of lung adenocarcinogenesis and would be applicable as a new biomarker for prognostication of patients with lung adenocarcinoma
24198276 Both Pbl and ECT2 repress Wg/Wnt target gene expression in cultured Drosophila and human cells.
23851435 Data suggest that ECT2 may play an oncogenic role in the pancreatic ductal adenocarcinoma (PDAC) neoplastic process.
23601845 miR-223 functions as a tumor suppresser in osteosarcoma and miR-223/Ect2/p21 signaling is an important pathway that regulates the osteosarcoma cell cycle progression and proliferaion
22898780 find that Ect2 first becomes active in prophase, when it is exported from the nucleus into the cytoplasm, activating RhoA to induce the formation of a mechanically stiff and rounded metaphase cortex
22683310 RASAL2 was identified as an ECT2-interacting protein that regulates RHO activity in astrocytoma cells.
22552385 ECT2 is important for tight junction function and maintenance of cell polarity. Nonfunction of this gene may cause renal tubulointerstitial injury, progressing to glomerular sclerosis.
22514687 Data supports an analogous function for the anillin-Ect2 complex in human cells and one hypothesis is that this complex has functionally replaced the Drosophila anillin-RacGAP50C complex.
22172673 targeting of Ect2 to the equatorial membrane represents a key step in the delivery of the cytokinetic signal to the cortex
21886810 identify Ect2 as a cell cycle-regulated protein and suggest that its ubiquitination-dependent degradation may play an important role in RhoA regulation at the time of mitosis.
21474972 Ect2 was a possible regulator of matrix-contact-side localization of invadopodia-related proteins.
21373644 A mechanism involving the nuclear GEFs Ect2 and Net1 for activating RhoB after genotoxic stress, thereby facilitating cell death after treatment with DNA damaging agents.
21189248 a model in which PKCiota-mediated phosphorylation regulates Ect2 binding to the oncogenic PKCiota-Par6 complex thereby activating Rac1 activity and driving transformed growth and invasion.
21124766 Results suggest that ECT2 is an indicator of cellular proliferation in OSCCs and that ECT2 might be a potential therapeutic target for the development of new treatments for OSCCs.
20734064 Observational study of gene-disease association. (HuGE Navigator)
19617897 Ect2 and PKCiota are genetically and functionally linked in NSCLC, acting to coordinately drive tumor cell proliferation and invasion through formation of an oncogenic PKCiota-Par6alpha-Ect2 complex.
19468302 Data found that Plk1 binds and directly phosphorylates the HsCYK-4 at the midzone and this modification creates a major docking site for the tandem BRCT repeats of the Rho GTP exchange factor Ect2.
19468300 Data showed how Plk1 promotes the central spindle recruitment of Ect2. Plk1 phosphorylates the noncatalytic N terminus of the RhoGAP HsCyk-4 at the central spindle, creating a phospho-epitope recognized by the BRCA1 C-terminal (BRCT) repeats of Ect2.
19118053 Immunohistochemical staining showed that a high level of ECT2 expression was associated with poor prognosis for patients with NSCLC (P = 0.0004) as well as ESCC (P = 0.0088).
19015243 study reports that mitotic complex genes Ect2, RacGAP, and MKLP1 are coordinately induced in S phase in proliferating T lymphocytes as well as in epithelial cells, depending upon activity of the CUX1 and E2F1 transcription factors
19008376 Data show that Trio, Ect2, and Vav3 are expressed at higher levels in glioblastoma versus low-grade glioma, and are involved in tumor cell migration and invasion.
18842503 Report correlation between ECT2 gene expression and methylation change of ECT2 promoter region in pancreatic cancer.
18642445 results suggest that co-regulation of Rho activity by p190RhoGAP and ECT2 in the cleavage furrow determines whether cells properly complete cytokinesis
18511905 Study demonstrates that FIP3 and ECT2 form mutually exclusive complexes with Cyk-4 and that dissociation of ECT2 from the mid-body at late telophase may be required for the recruitment of FIP3 and recycling endosomes to the cleavage furrow.
17942602 These results suggest that equatorial Ect2 locally suppresses lamellipodia formation via RhoA activation, which indirectly contributes to restricting lamellipodia formation to polar regions during cytokinesis B.
17688947 This gene was silenced.
17488623 Late mitotic Plk1 activity promotes recruitment of Ect2 to the central spindle, triggering the initiation of cytokinesis and contributing to cleavage plane specification in human cells.
16862181 Aberrant ECT2 expression, observed in various human tumors, could be the direct result of RB/E2F pathway deficiency, thereby contributing to cell division in cancers.
16803869 In mitotic cells Ect2 localizes to the central spindle and to the cell cortex.
16778203 ECT2 knockdown triggers cell cycle arrest in G1.
16352658 Data show that RhoA accumulates at the equatorial cortex before furrow initiation and continues to concentrate at the cleavage furrow during cytokinesis, and that centralspindlin and ECT2 are required for this localization and furrowing.
16247472 ECT2 is regulated by Plk1 and CDK1, phosphorylation of ECT2 leads to accumulation of RHOA
16170345 a conformational change of ECT2 upon phosphorylation at T341. Therefore, ECT2 activity might be regulated by the phosphorylation status of T341.
16129829 MgcRacGAP controls the initiation of cytokinesis by regulating ECT2, which in turn induces the assembly of the contractile ring and triggers the ingression of the cleavage furrow
16118207 Cdk1 inactivation is sufficient to activate a signaling pathway leading to cytokinesis, which emanates from mitotic spindles and is regulated by ECT2, MgcRacGAP, and RhoA
16103226 Central spindle localization of ECT2 assists division plane positioning and the CYK-4 subunit of centralspindlin acts upstream of RhoA to promote furrow assembly.
15642749 Ect2 regulates the activation and function of Cdc42 in mitosis.
15545273 BRCT domains negatively regulate Ect2 GEF activity in interphase cells, and they are also required for the proper function of Ect2 during cytokinesis
15254234 ECT2 regulates the polarity complex Par6/Par3/PKCzeta and possibly plays a role in epithelial cell polarity
14587037 XRCC1, CLB6, and BRCT domains of ECT2 play a critical role in regulating cytokinesis

AA Sequence

MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAGKQEELIKALK      1 - 70
TIKIMEVPVIKIKESCPGKSDEKLIKSVINMDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFND     71 - 140
LYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDF    141 - 210
NSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLG    211 - 280
FSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGET    281 - 350
MYLYEKANTPELKKSVSMLSLNTPNSNRKRRRLKETLAQLSRETDVSPFPPRKRPSAEHSLSIGSLLDIS    351 - 420
NTPESSINYGDTPKSCTKSSKSSTPVPSKQSARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRGG    421 - 490
PILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMSKET    491 - 560
IIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGS    561 - 630
LKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDC    631 - 700
LEIARKRHKVIGTFRSPHGQTRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLS    701 - 770
FQMTSDELPKENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRA    771 - 840
FSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSRLSSTSSLAGIPSPSLVSLPSFFERRSHTLSRST    841 - 910
THLI                                                                      911 - 914
//

Text Mined References (83)

PMID Year Title
26211594 2015 Elevated expression of ECT2 predicts unfavorable prognosis in patients with colorectal cancer.
25674238 2014 Up-regulation of ECT2 is associated with poor prognosis in gastric cancer patients.
25617497 2015 ECT2 regulates the Rho/ERK signalling axis to promote early recurrence in human hepatocellular carcinoma.
25486482 2014 Centralspindlin assembly and 2 phosphorylations on MgcRacGAP by Polo-like kinase 1 initiate Ect2 binding in early cytokinesis.
25486481 2014 Poly(ADP-ribosyl)ation is recognized by ECT2 during mitosis.
25237947 Epithelial cell transformation sequence 2 is a potential biomarker of unfavorable survival in human gliomas.
25068414 2014 Crystal structure of triple-BRCT-domain of ECT2 and insights into the binding characteristics to CYK-4.
24784921 2014 Prognostic value of microRNA-223/epithelial cell transforming sequence 2 signaling in patients with osteosarcoma.
24484057 2014 ECT2 amplification and overexpression as a new prognostic biomarker for early-stage lung adenocarcinoma.
24198276 2013 Pebble/ECT2 RhoGEF negatively regulates the Wingless/Wnt signaling pathway.
23851435 2013 Integrated genomic, transcriptomic, and RNA-interference analysis of genes in somatic copy number gains in pancreatic ductal adenocarcinoma.
23601845 2013 MiR-223/Ect2/p21 signaling regulates osteosarcoma cell cycle progression and proliferation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22898780 2012 Changes in Ect2 localization couple actomyosin-dependent cell shape changes to mitotic progression.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22683310 2012 ECT2 and RASAL2 mediate mesenchymal-amoeboid transition in human astrocytoma cells.
22552385 2012 Nonfunction of the ECT2 gene may cause renal tubulointerstitial injury leading to focal segmental glomerulosclerosis.
22514687 2012 An anillin-Ect2 complex stabilizes central spindle microtubules at the cortex during cytokinesis.
22172673 2011 Targeting of the RhoGEF Ect2 to the equatorial membrane controls cleavage furrow formation during cytokinesis.
21886810 2011 APC(cdh1) mediates degradation of the oncogenic Rho-GEF Ect2 after mitosis.
21474972 2011 Localization of the invadopodia-related proteins actinin-1 and cortactin to matrix-contact-side cytoplasm of cancer cells in surgically resected lung adenocarcinomas.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21373644 2011 The nuclear guanine nucleotide exchange factors Ect2 and Net1 regulate RhoB-mediated cell death after DNA damage.
21189248 2011 Oncogenic activity of Ect2 is regulated through protein kinase C iota-mediated phosphorylation.
21124766 2010 Epithelial cell transforming sequence 2 in human oral cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20047078 2010 Downregulation of cough by exercise and voluntary hyperpnea.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19617897 2009 Ect2 links the PKCiota-Par6alpha complex to Rac1 activation and cellular transformation.
19468302 2009 Plk1 self-organization and priming phosphorylation of HsCYK-4 at the spindle midzone regulate the onset of division in human cells.
19468300 2009 Polo-like kinase 1 directs assembly of the HsCyk-4 RhoGAP/Ect2 RhoGEF complex to initiate cleavage furrow formation.
19129481 2009 Centrosome/spindle pole-associated protein regulates cytokinesis via promoting the recruitment of MyoGEF to the central spindle.
19118053 2009 Involvement of epithelial cell transforming sequence-2 oncoantigen in lung and esophageal cancer progression.
19015243 2009 CUX1 and E2F1 regulate coordinated expression of the mitotic complex genes Ect2, MgcRacGAP, and MKLP1 in S phase.
19008376 2008 The guanine nucleotide exchange factors trio, Ect2, and Vav3 mediate the invasive behavior of glioblastoma.
18842503 2008 Correlation between ECT2 gene expression and methylation change of ECT2 promoter region in pancreatic cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18642445 2008 Opposing roles of p190RhoGAP and Ect2 RhoGEF in regulating cytokinesis.
18511905 2008 Sequential Cyk-4 binding to ECT2 and FIP3 regulates cleavage furrow ingression and abscission during cytokinesis.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18201571 2008 Phosphoregulation of MgcRacGAP in mitosis involves Aurora B and Cdk1 protein kinases and the PP2A phosphatase.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17942602 2008 Novel functions of Ect2 in polar lamellipodia formation and polarity maintenance during "contractile ring-independent" cytokinesis in adherent cells.
17688947 2007 A novel shRNA vector that enables rapid selection and identification of knockdown cells.
17488623 2007 Polo-like kinase 1 triggers the initiation of cytokinesis in human cells by promoting recruitment of the RhoGEF Ect2 to the central spindle.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17115030 2006 The armadillo protein p0071 regulates Rho signalling during cytokinesis.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16862181 2007 RB silencing compromises the DNA damage-induced G2/M checkpoint and causes deregulated expression of the ECT2 oncogene.
16803869 2006 Influence of human Ect2 depletion and overexpression on cleavage furrow formation and abscission.
16778203 2006 The epithelial cell transforming sequence 2, a guanine nucleotide exchange factor for Rho GTPases, is repressed by p53 via protein methyltransferases and is required for G1-S transition.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16495035 2006 Nucleotide exchange factor ECT2 regulates epithelial cell polarity.
16352658 2006 Centralspindlin regulates ECT2 and RhoA accumulation at the equatorial cortex during cytokinesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16247472 2006 Phosphorylation of the cytokinesis regulator ECT2 at G2/M phase stimulates association of the mitotic kinase Plk1 and accumulation of GTP-bound RhoA.
16236794 2006 Dissecting the role of Rho-mediated signaling in contractile ring formation.
16170345 2006 Cytokinesis regulator ECT2 changes its conformation through phosphorylation at Thr-341 in G2/M phase.
16129829 2005 MgcRacGAP controls the assembly of the contractile ring and the initiation of cytokinesis.
16118207 2005 Inhibition of cyclin-dependent kinase 1 induces cytokinesis without chromosome segregation in an ECT2 and MgcRacGAP-dependent manner.
16103226 2005 An ECT2-centralspindlin complex regulates the localization and function of RhoA.
15642749 2005 Ect2 and MgcRacGAP regulate the activation and function of Cdc42 in mitosis.
15545273 2005 The tandem BRCT domains of Ect2 are required for both negative and positive regulation of Ect2 in cytokinesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254234 2004 Nucleotide exchange factor ECT2 interacts with the polarity protein complex Par6/Par3/protein kinase Czeta (PKCzeta) and regulates PKCzeta activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14668487 2004 Novel kelch-like protein, KLEIP, is involved in actin assembly at cell-cell contact sites of Madin-Darby canine kidney cells.
14645260 2004 Deregulation and mislocalization of the cytokinesis regulator ECT2 activate the Rho signaling pathways leading to malignant transformation.
14587037 2003 Rho exchange factor ECT2 is induced by growth factors and regulates cytokinesis through the N-terminal cell cycle regulator-related domains.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376551 2002 RhoG signals in parallel with Rac1 and Cdc42.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
10837491 2000 Accumulation of GTP-bound RhoA during cytokinesis and a critical role of ECT2 in this accumulation.
10579713 1999 Human ECT2 is an exchange factor for Rho GTPases, phosphorylated in G2/M phases, and involved in cytokinesis.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8464478 1993 Oncogene ect2 is related to regulators of small GTP-binding proteins.
7665179 1995 Chromosomal localization of the human ECT2 proto-oncogene to 3q26.1-->q26.2 by somatic cell analysis and fluorescence in situ hybridization.