Property Summary

NCBI Gene PubMed Count 70
Grant Count 41
R01 Count 26
Funding $1,844,066.07
PubMed Score 74.00
PubTator Score 88.96

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (48)

PMID Text
26211594 Colorectal cancer patients with high expression levels of ECT2 had shorter overall survival.
25674238 Up-regulation of ECT2 might contribute to the progression of gastric carcinogenesis and may be a useful prognostic indicator in gastric cancer.
25617497 ECT2 can crosstalk with RACGAP1 to catalyse the GTP exchange involved in Rho signalling to further regulate tumour initiation and metastasis.
25486482 central spindle assembly and 2 Plk1-dependent phosphorylations are required to establish efficient binding of the Ect2 BRCT in early cytokinesis.
25486481 Poly(ADP-ribosyl)ation is recognized by ECT2.
25237947 ECT2 expression is positively correlated with WHO pathologic grading and unfavorable survival, suggesting that ECT2 may be a potential therapeutic candidate in human gliomas.
25068414 structure of triple-BRCT-domain of ECT2 and insights into the binding characteristics to CYK-4
24784921 the deregulation of miR-223 and its target gene ECT2 may be associated with the aggressive tumor progression of human osteosarcoma
24484057 Abnormality of the ECT2 gene occurs at a relatively early stage of lung adenocarcinogenesis and would be applicable as a new biomarker for prognostication of patients with lung adenocarcinoma
24198276 Both Pbl and ECT2 repress Wg/Wnt target gene expression in cultured Drosophila and human cells.
More...

AA Sequence

MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAGKQEELIKALK      1 - 70
TIKIMEVPVIKIKESCPGKSDEKLIKSVINMDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFND     71 - 140
LYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDF    141 - 210
NSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLG    211 - 280
FSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGET    281 - 350
MYLYEKANTPELKKSVSMLSLNTPNSNRKRRRLKETLAQLSRETDVSPFPPRKRPSAEHSLSIGSLLDIS    351 - 420
NTPESSINYGDTPKSCTKSSKSSTPVPSKQSARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRGG    421 - 490
PILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMSKET    491 - 560
IIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGS    561 - 630
LKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDC    631 - 700
LEIARKRHKVIGTFRSPHGQTRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLS    701 - 770
FQMTSDELPKENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRA    771 - 840
FSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSRLSSTSSLAGIPSPSLVSLPSFFERRSHTLSRST    841 - 910
THLI                                                                      911 - 914
//

Text Mined References (83)

PMID Year Title
26211594 2015 Elevated expression of ECT2 predicts unfavorable prognosis in patients with colorectal cancer.
25674238 2014 Up-regulation of ECT2 is associated with poor prognosis in gastric cancer patients.
25617497 2015 ECT2 regulates the Rho/ERK signalling axis to promote early recurrence in human hepatocellular carcinoma.
25486482 2014 Centralspindlin assembly and 2 phosphorylations on MgcRacGAP by Polo-like kinase 1 initiate Ect2 binding in early cytokinesis.
25486481 2014 Poly(ADP-ribosyl)ation is recognized by ECT2 during mitosis.
25237947 Epithelial cell transformation sequence 2 is a potential biomarker of unfavorable survival in human gliomas.
25068414 2014 Crystal structure of triple-BRCT-domain of ECT2 and insights into the binding characteristics to CYK-4.
24784921 2014 Prognostic value of microRNA-223/epithelial cell transforming sequence 2 signaling in patients with osteosarcoma.
24484057 2014 ECT2 amplification and overexpression as a new prognostic biomarker for early-stage lung adenocarcinoma.
24198276 2013 Pebble/ECT2 RhoGEF negatively regulates the Wingless/Wnt signaling pathway.
More...