Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.80
PubTator Score 0.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Disease Target Count P-value
glioblastoma 5792 2.2e-05
atypical teratoid / rhabdoid tumor 5112 2.5e-05
osteosarcoma 7950 3.0e-05
astrocytoma 1146 1.1e-02
spina bifida 1074 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.100 1.1e-02
atypical teratoid / rhabdoid tumor 1.200 2.5e-05
glioblastoma 1.200 2.2e-05
osteosarcoma 1.426 3.0e-05
spina bifida -1.070 2.8e-02

Synonym

Accession Q9H8U3 Q5SZZ0 Q5SZZ1
Symbols TEX27

Gene

PDB

1X4W  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNN      1 - 70
TSITTPTLSPSQQPLPTELNVTSPSKEECGPCTDTAHVSLITPTKRSCGTDSQSENEASPVKRPRLLENT     71 - 140
ERSEETSRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGREEAIMKMVK    141 - 210
LDRKVGRSCQRIGEGCS                                                         211 - 227
//

Text Mined References (12)

PMID Year Title