Property Summary

NCBI Gene PubMed Count 24
Grant Count 49
R01 Count 35
Funding $7,428,285.75
PubMed Score 680.75
PubTator Score 123.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
esophageal adenocarcinoma -1.200 0.032
glioblastoma -1.300 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.100 0.002
pediatric high grade glioma -1.100 0.000
subependymal giant cell astrocytoma -1.208 0.022
spina bifida -1.505 0.040
ovarian cancer -1.100 0.000

Gene RIF (11)

PMID Text
26110528 AKTIP interacts with telomeric DNA and is required for telomere maintenance.
25151576 High fused toes homolog expression is associated with radioresistance in cervical cancer.
24971934 FTS silencing reduced EMT and cell migration by EGF treatment. These results demonstrate a novel function for FTS in EGF-mediated EMT process.
24022875 *AKTIP single nucleotide polymorphisms are not associated with late-onset depression patients compared to healthy elderly controls.
21424602 Targeted inhibition of FTS led to the shutdown of key elemental characteristics of cervical cancer and could lead to an effective therapeutic strategy.
20945372 These data unraveled the involvement of new oncoprotein FTS in cervical cancer which plays a central role in carcinogenesis.
20635389 Observational study of gene-disease association. (HuGE Navigator)
20132317 Demographic and clinical characteristics and AKT1 single markers and haplotypes, but not AKTIP polymorphisms or interactions between AKT1 and AKTIP, are associated with increased risk for suicidal behavior in bipolar patients.
19270026 Observational study of gene-disease association. (HuGE Navigator)
18799622 These data suggest that the FTS/Hook/FHIP complex functions to promote vesicle trafficking and/or fusion via the homotypic vacuolar protein sorting complex.
More...

AA Sequence

MNPFWSMSTSSVRKRSEGEEKTLTGDVKTSPPRTAPKKQLPSIPKNALPITKPTSPAPAAQSTNGTHASY      1 - 70
GPFYLEYSLLAEFTLVVKQKLPGVYVQPSYRSALMWFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRL     71 - 140
VFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASPLNPEAAVLYEKDIQLFK    141 - 210
SKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSV    211 - 280
QPFSKEEKTVAT                                                              281 - 292
//

Text Mined References (25)

PMID Year Title
26110528 2015 AKTIP/Ft1, a New Shelterin-Interacting Factor Required for Telomere Maintenance.
25416956 2014 A proteome-scale map of the human interactome network.
25151576 2015 FTS is responsible for radiation-induced nuclear phosphorylation of EGFR and repair of DNA damage in cervical cancer cells.
24971934 2014 EGF-induced expression of Fused Toes Homolog (FTS) facilitates epithelial-mesenchymal transition and promotes cell migration in ME180 cervical cancer cells.
24022875 2014 Genetic variant of AKT1 and AKTIP associated with late-onset depression in a Brazilian population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21424602 2011 Fused Toes Homolog modulates radiation cytotoxicity in uterine cervical cancer cells.
20945372 2011 FTS (fused toes homolog) a novel oncoprotein involved in uterine cervical carcinogenesis and a potential diagnostic marker for cervical cancer.
20635389 2011 Common alleles in candidate susceptibility genes associated with risk and development of epithelial ovarian cancer.
20132317 2010 Association between AKT1 but not AKTIP genetic variants and increased risk for suicidal behavior in bipolar patients.
More...