Property Summary

NCBI Gene PubMed Count 27
PubMed Score 714.61
PubTator Score 123.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
esophageal adenocarcinoma -1.200 3.2e-02
glioblastoma -1.100 2.1e-03
group 3 medulloblastoma -1.100 1.7e-04
medulloblastoma, large-cell -2.200 3.1e-05
ovarian cancer -1.100 4.0e-05
pediatric high grade glioma -1.100 2.9e-05
primitive neuroectodermal tumor -1.100 1.6e-03
spina bifida -1.505 4.0e-02
subependymal giant cell astrocytoma -1.208 2.2e-02

Protein-protein Interaction (8)

Gene RIF (14)

AA Sequence

MNPFWSMSTSSVRKRSEGEEKTLTGDVKTSPPRTAPKKQLPSIPKNALPITKPTSPAPAAQSTNGTHASY      1 - 70
GPFYLEYSLLAEFTLVVKQKLPGVYVQPSYRSALMWFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRL     71 - 140
VFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASPLNPEAAVLYEKDIQLFK    141 - 210
SKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSV    211 - 280
QPFSKEEKTVAT                                                              281 - 292
//

Text Mined References (28)

PMID Year Title