Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H8Q6
Symbols C15orf34

Gene

 Compartment GO Term (0)

AA Sequence

MTGKNVYFQSQLEAFHCLQYELFPSRLTINLLVTTHIPFPQTKPHIARCVFTESSKILLGLWVQDGECSE      1 - 70
IMTGAWSCRALRRKSRNLFSEQLKIIPKDLHFRNTMLSSCIRNQLGGPFLLEVENNERLNYRSGEGRQL      71 - 139
//

Text Mined References (4)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.