Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
Tay-Sachs disease 6

Synonym

Accession Q9H8Q6
Symbols C15orf34

Gene

 Compartment GO Term (0)

AA Sequence

MTGKNVYFQSQLEAFHCLQYELFPSRLTINLLVTTHIPFPQTKPHIARCVFTESSKILLGLWVQDGECSE      1 - 70
IMTGAWSCRALRRKSRNLFSEQLKIIPKDLHFRNTMLSSCIRNQLGGPFLLEVENNERLNYRSGEGRQL      71 - 139
//

Text Mined References (4)

PMID Year Title