Property Summary

NCBI Gene PubMed Count 15
PubMed Score 25.47
PubTator Score 18.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis 1.207 3.6e-02
acute myeloid leukemia -1.500 1.4e-02
astrocytic glioma -1.100 1.0e-02
Breast cancer 1.400 5.7e-07
breast carcinoma 1.400 2.5e-30
chronic rhinosinusitis 1.127 4.0e-02
ductal carcinoma in situ 1.900 4.8e-03
ependymoma -2.000 1.9e-02
group 4 medulloblastoma -1.300 2.1e-04
intraductal papillary-mucinous carcinoma... 1.200 4.6e-02
intraductal papillary-mucinous neoplasm ... 1.500 7.1e-03
invasive ductal carcinoma 1.500 7.0e-03
lung adenocarcinoma 1.300 2.7e-05
medulloblastoma, large-cell 1.100 6.3e-03
nasopharyngeal carcinoma -1.100 5.1e-03
non-small cell lung cancer 1.247 2.3e-09
oligodendroglioma -1.400 4.7e-02
ovarian cancer 2.300 2.6e-06
pancreatic cancer 1.100 2.7e-03
psoriasis 1.200 3.6e-03
tuberculosis 1.400 1.6e-07

Gene RIF (10)

AA Sequence

MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFD      1 - 70
VPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQFQGGELALSAFLVLVFLWLHS     71 - 140
LRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYITGKNLLMQARWFHILGMMMF    141 - 210
IWSSAHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLV    211 - 280
VTNVFFNQALSAFLSHQFYKSKFVSYPKHRKAFLPFLF                                    281 - 318
//

Text Mined References (17)

PMID Year Title