Property Summary

NCBI Gene PubMed Count 35
PubMed Score 16.41
PubTator Score 19.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis -1.572 9.0e-03
atypical teratoid / rhabdoid tumor 1.100 1.3e-02
group 3 medulloblastoma -1.200 1.6e-03
lung carcinoma 1.300 3.5e-22
medulloblastoma, large-cell 1.200 4.9e-05
osteosarcoma -1.576 4.2e-04
tuberculosis 1.200 2.5e-04

 MGI Phenotype (1)

Gene RIF (15)

AA Sequence

MIGCGACEPKVKMAGGQAAAALPTWKMAARRSLSARGRGILQAAAGRLLPLLLLSCCCGAGGCAAVGENE      1 - 70
ETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAFTEHERRRHSPGERGLGGPAP     71 - 140
PEPDSGPQRCGIRTSDIIILPHIILNRRTSGIIEIEIKPLRKMEKSKSYYLCTSLSTPALGAGGSGSTGG    141 - 210
AVGGKGGSGVAGLPPPPWAETTWIYHDGEDTKMIVGEEKKFLLPFWLQVIFISLLLCLSGMFSGLNLGLM    211 - 280
ALDPMELRIVQNCGTEKEKNYAKRIEPVRRQGNYLLCSLLLGNVLVNTTLTILLDDIAGSGLVAVVVSTI    281 - 350
GIVIFGEIVPQAICSRHGLAVGANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEIGTVYNREKLLEMLRV    351 - 420
TDPYNDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSN    421 - 490
IVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQRVNNEGEGDPF    491 - 560
YEVLGIVTLEDVIEEIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQLLLAMHR    561 - 630
FLATEVEAFSPSQMSEKILLRLLKHPNVIQELKYDEKNKKAPEYYLYQRNKPVDYFVLILQGKVEVEAGK    631 - 700
EGMKFEASAFSYYGVMALTASPVPLSLSRTFVVSRTELLAAGSPGENKSPPRPCGLNHSDSLSRSDRIDA    701 - 770
VTPTLGSSNNQLNSSLLQVYIPDYSVRALSDLQFVKISRQQYQNALMASRMDKTPQSSDSENTKIELTLT    771 - 840
ELHDGLPDETANLLNEQNCVTHSKANHSLHNEGAI                                       841 - 875
//

Text Mined References (38)

PMID Year Title