Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.500 1.2e-03
astrocytic glioma -1.600 6.9e-03
ependymoma -1.300 3.3e-02
intraductal papillary-mucinous neoplasm ... 1.200 8.5e-03
medulloblastoma -1.100 7.5e-06
medulloblastoma, large-cell -1.900 1.9e-04
oligodendroglioma -1.300 1.7e-02
ovarian cancer 1.300 6.2e-04
psoriasis -1.300 3.8e-04

Gene RIF (1)

AA Sequence

MAARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAP      1 - 70
LINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVV     71 - 140
TLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVA    141 - 210
AFERRACKLYGPETNIPRELMLHEVHHT                                              211 - 238
//

Text Mined References (7)

PMID Year Title