Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.600 0.007
ependymoma -1.300 0.033
oligodendroglioma -1.300 0.017
psoriasis -1.300 0.000
sonic hedgehog group medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.900 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.009
acute myeloid leukemia 1.500 0.001
ovarian cancer 1.300 0.001

Synonym

Accession Q9H8M1 B7Z1Y4
Symbols

Gene

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAP      1 - 70
LINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVV     71 - 140
TLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVA    141 - 210
AFERRACKLYGPETNIPRELMLHEVHHT                                              211 - 238
//

Text Mined References (7)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.