Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.93
PubTator Score 10.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer -1.100 4.9e-07
breast carcinoma -1.200 2.6e-04
ductal carcinoma in situ -1.400 1.3e-04
intraductal papillary-mucinous adenoma (... -2.100 9.3e-04
intraductal papillary-mucinous carcinoma... -2.200 8.6e-04
intraductal papillary-mucinous neoplasm ... -1.200 2.4e-04
invasive ductal carcinoma -2.200 1.9e-04
juvenile dermatomyositis 1.224 1.9e-08
lung adenocarcinoma -1.300 4.5e-16
lung cancer -1.300 1.9e-03
medulloblastoma, large-cell -1.300 2.5e-04
nephrosclerosis 1.369 9.3e-05
non-small cell lung cancer -1.909 6.6e-15
osteosarcoma -2.160 8.9e-03
ovarian cancer 1.200 1.3e-02

Gene RIF (3)

AA Sequence

MILSLLFSLGGPLGWGLLGAWAQASSTSLSDLQSSRTPGVWKAEAEDTGKDPVGRNWCPYPMSKLVTLLA      1 - 70
LCKTEKFLIHSQQPCPQGAPDCQKVKVMYRMAHKPVYQVKQKVLTSLAWRCCPGYTGPNCEHHDSMAIPE     71 - 140
PADPGDSHQEPQDGPVSFKPGHLAAVINEVEVQQEQQEHLLGDLQNDVHRVADSLPGLWKALPGNLTAAV    141 - 210
MEANQTGHEFPDRSLEQVLLPHVDTFLQVHFSPIWRSFNQSLHSLTQAIRNLSLDVEANRQAISRVQDSA    211 - 280
VARADFQELGAKFEAKVQENTQRVGQLRQDVEDRLHAQHFTLHRSISELQADVDTKLKRLHKAQEAPGTN    281 - 350
GSLVLATPGAGARPEPDSLQARLGQLQRNLSELHMTTARREEELQYTLEDMRATLTRHVDEIKELYSESD    351 - 420
ETFDQISKVERQVEELQVNHTALRELRVILMEKSLIMEENKEEVERQLLELNLTLQHLQGGHADLIKYVK    421 - 490
DCNCQKLYLDLDVIREGQRDATRALEETQVSLDERRQLDGSSLQALQNAVDAVSLAVDAHKAEGERARAA    491 - 560
TSRLRSQVQALDDEVGALKAAAAEARHEVRQLHSAFAALLEDALRHEAVLAALFGEEVLEEMSEQTPGPL    561 - 630
PLSYEQIRVALQDAASGLQEQALGWDELAARVTALEQASEPPRPAEHLEPSHDAGREEAATTALAGLARE    631 - 700
LQSLSNDVKNVGRCCEAEAGAGAASLNASLHGLHNALFATQRSLEQHQRLFHSLFGNFQGLMEANVSLDL    701 - 770
GKLQTMLSRKGKKQQKDLEAPRKRDKKEAEPLVDIRVTGPVPGALGAALWEAGSPVAFYASFSEGTAALQ    771 - 840
TVKFNTTYINIGSSYFPEHGYFRAPERGVYLFAVSVEFGPGPGTGQLVFGGHHRTPVCTTGQGSGSTATV    841 - 910
FAMAELQKGERVWFELTQGSITKRSLSGTAFGGFLMFKT                                   911 - 949
//

Text Mined References (21)

PMID Year Title