Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.50
PubTator Score 10.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H8L6 Q504V7 Q6P2N2
Symbols EMILIN3
EMILIN-3
ENDOGLYX-1

Gene

Gene RIF (2)

PMID Text
25745997 Results suggest that CLEC14A-MMRN2 binding has a role in inducing sprouting angiogenesis during tumor growth, which has the potential to be manipulated in future antiangiogenic therapy design.
23979707 CLEC14A is a matrix component which binds to MMRN2 in the process of endothelial cells transformation in tumor angiogenesis.

AA Sequence

MILSLLFSLGGPLGWGLLGAWAQASSTSLSDLQSSRTPGVWKAEAEDTGKDPVGRNWCPYPMSKLVTLLA      1 - 70
LCKTEKFLIHSQQPCPQGAPDCQKVKVMYRMAHKPVYQVKQKVLTSLAWRCCPGYTGPNCEHHDSMAIPE     71 - 140
PADPGDSHQEPQDGPVSFKPGHLAAVINEVEVQQEQQEHLLGDLQNDVHRVADSLPGLWKALPGNLTAAV    141 - 210
MEANQTGHEFPDRSLEQVLLPHVDTFLQVHFSPIWRSFNQSLHSLTQAIRNLSLDVEANRQAISRVQDSA    211 - 280
VARADFQELGAKFEAKVQENTQRVGQLRQDVEDRLHAQHFTLHRSISELQADVDTKLKRLHKAQEAPGTN    281 - 350
GSLVLATPGAGARPEPDSLQARLGQLQRNLSELHMTTARREEELQYTLEDMRATLTRHVDEIKELYSESD    351 - 420
ETFDQISKVERQVEELQVNHTALRELRVILMEKSLIMEENKEEVERQLLELNLTLQHLQGGHADLIKYVK    421 - 490
DCNCQKLYLDLDVIREGQRDATRALEETQVSLDERRQLDGSSLQALQNAVDAVSLAVDAHKAEGERARAA    491 - 560
TSRLRSQVQALDDEVGALKAAAAEARHEVRQLHSAFAALLEDALRHEAVLAALFGEEVLEEMSEQTPGPL    561 - 630
PLSYEQIRVALQDAASGLQEQALGWDELAARVTALEQASEPPRPAEHLEPSHDAGREEAATTALAGLARE    631 - 700
LQSLSNDVKNVGRCCEAEAGAGAASLNASLHGLHNALFATQRSLEQHQRLFHSLFGNFQGLMEANVSLDL    701 - 770
GKLQTMLSRKGKKQQKDLEAPRKRDKKEAEPLVDIRVTGPVPGALGAALWEAGSPVAFYASFSEGTAALQ    771 - 840
TVKFNTTYINIGSSYFPEHGYFRAPERGVYLFAVSVEFGPGPGTGQLVFGGHHRTPVCTTGQGSGSTATV    841 - 910
FAMAELQKGERVWFELTQGSITKRSLSGTAFGGFLMFKT                                   911 - 949
//

Text Mined References (20)

PMID Year Title
25745997 2015 Blocking CLEC14A-MMRN2 binding inhibits sprouting angiogenesis and tumour growth.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22532453 2012 Identification of ovarian cancer-associated proteins in symptomatic women: A novel method for semi-quantitative plasma proteomics.
22334695 2012 EMILIN-3, peculiar member of elastin microfibril interface-located protein (EMILIN) family, has distinct expression pattern, forms oligomeric assemblies, and serves as transforming growth factor ? (TGF-?) antagonist.
22020326 2012 MULTIMERIN2 impairs tumor angiogenesis and growth by interfering with VEGF-A/VEGFR2 pathway.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18327805 2008 N-glycoprotein profiling of lung adenocarcinoma pleural effusions by shotgun proteomics.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...