Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.65
PubTator Score 0.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 9.56410153324863E-6
glioblastoma 5572 9.67821780941349E-5
psoriasis 6685 0.00130172932291305
lung cancer 4473 0.00146699930198101
astrocytic glioma 2241 0.0200335889424355
oligodendroglioma 2849 0.0368914604258754
ependymoma 2514 0.0460208603520012
subependymal giant cell astrocytoma 2287 0.049945351378786
Disease Target Count Z-score Confidence
Rickets 42 3.425 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.300 0.020
ependymoma -1.200 0.046
oligodendroglioma -1.100 0.037
psoriasis -2.100 0.001
osteosarcoma -2.162 0.000
glioblastoma -1.200 0.000
lung cancer 2.300 0.001
subependymal giant cell astrocytoma -1.195 0.050

Synonym

Accession Q9H8K7 Q0P6C6 Q8N597
Symbols

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG
Cow OMA Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20418485 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

METRTEDGGLTRRPTLASSWDVAGGALTHSLLLTRAGLGPGDFDWEELLAPPAPGQDLVILKRNHNNKDE      1 - 70
NPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGEEYCGTSRGKNVCTVLDDSEHEKIILYKKNLKLESS     71 - 140
THACKIKLLSFGERQCVFISKVVVHMRSVFANSSTSSPALGSRIDLDKVQTIMESMGSKLSPGAQQLMDM    141 - 210
VRCQQRNCIPIGEQLQSVLGNSGYKHMIGLQSSSTLGTLNKSSSTPFPFRTGLTSGNVTENLQTYIDKST    211 - 280
QLPGGENSTKLDECKVMPQNHSFLENDLKNAMASFLPKKVSDNSNIPNSELLPFLQNLCSQVNHLHVGNK    281 - 350
TECQENITKHGERILGVGMEEQSICSYLEKILSKNMELMEKKLMDYIDQRIHELQEHIDDKIALLLDLLQ    351 - 420
NPNSPPTGIPLRHYDSGERLSNGER                                                 421 - 445
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22785457 2012 Association of vitamin D-related gene polymorphisms with manifestation of vitamin D deficiency in children.
20418485 2010 Genome-wide association study of circulating vitamin D levels.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.