Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.65
PubTator Score 0.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 9.6e-06
glioblastoma 5792 9.7e-05
psoriasis 6694 1.3e-03
lung cancer 4740 1.5e-03
astrocytic glioma 2597 2.0e-02
oligodendroglioma 2850 3.7e-02
ependymoma 4679 4.6e-02
subependymal giant cell astrocytoma 2287 5.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Rickets 49 3.452 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.300 2.0e-02
ependymoma -1.200 4.6e-02
glioblastoma -1.200 9.7e-05
lung cancer 2.300 1.5e-03
oligodendroglioma -1.100 3.7e-02
osteosarcoma -2.162 9.6e-06
psoriasis -2.100 1.3e-03
subependymal giant cell astrocytoma -1.195 5.0e-02

Synonym

Accession Q9H8K7 Q0P6C6 Q8N597
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

METRTEDGGLTRRPTLASSWDVAGGALTHSLLLTRAGLGPGDFDWEELLAPPAPGQDLVILKRNHNNKDE      1 - 70
NPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGEEYCGTSRGKNVCTVLDDSEHEKIILYKKNLKLESS     71 - 140
THACKIKLLSFGERQCVFISKVVVHMRSVFANSSTSSPALGSRIDLDKVQTIMESMGSKLSPGAQQLMDM    141 - 210
VRCQQRNCIPIGEQLQSVLGNSGYKHMIGLQSSSTLGTLNKSSSTPFPFRTGLTSGNVTENLQTYIDKST    211 - 280
QLPGGENSTKLDECKVMPQNHSFLENDLKNAMASFLPKKVSDNSNIPNSELLPFLQNLCSQVNHLHVGNK    281 - 350
TECQENITKHGERILGVGMEEQSICSYLEKILSKNMELMEKKLMDYIDQRIHELQEHIDDKIALLLDLLQ    351 - 420
NPNSPPTGIPLRHYDSGERLSNGER                                                 421 - 445
//

Text Mined References (8)

PMID Year Title