Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.65
PubTator Score 0.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.300 0.020
ependymoma -1.200 0.046
oligodendroglioma -1.100 0.037
psoriasis -2.100 0.001
osteosarcoma -2.162 0.000
glioblastoma -1.200 0.000
lung cancer 2.300 0.001
subependymal giant cell astrocytoma -1.195 0.050

Synonym

Accession Q9H8K7 Q0P6C6 Q8N597
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20418485 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

METRTEDGGLTRRPTLASSWDVAGGALTHSLLLTRAGLGPGDFDWEELLAPPAPGQDLVILKRNHNNKDE      1 - 70
NPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGEEYCGTSRGKNVCTVLDDSEHEKIILYKKNLKLESS     71 - 140
THACKIKLLSFGERQCVFISKVVVHMRSVFANSSTSSPALGSRIDLDKVQTIMESMGSKLSPGAQQLMDM    141 - 210
VRCQQRNCIPIGEQLQSVLGNSGYKHMIGLQSSSTLGTLNKSSSTPFPFRTGLTSGNVTENLQTYIDKST    211 - 280
QLPGGENSTKLDECKVMPQNHSFLENDLKNAMASFLPKKVSDNSNIPNSELLPFLQNLCSQVNHLHVGNK    281 - 350
TECQENITKHGERILGVGMEEQSICSYLEKILSKNMELMEKKLMDYIDQRIHELQEHIDDKIALLLDLLQ    351 - 420
NPNSPPTGIPLRHYDSGERLSNGER                                                 421 - 445
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22785457 2012 Association of vitamin D-related gene polymorphisms with manifestation of vitamin D deficiency in children.
20418485 2010 Genome-wide association study of circulating vitamin D levels.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.