Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.32
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active ulcerative colitis -1.370 4.8e-02
astrocytoma 1.400 1.9e-02
atypical teratoid / rhabdoid tumor -2.600 5.6e-04
Breast cancer -1.500 3.3e-08
breast carcinoma -1.300 1.8e-04
chronic rhinosinusitis -1.334 1.2e-02
colon cancer -1.400 2.2e-02
cystic fibrosis -1.200 8.4e-04
Down syndrome 1.200 1.1e-02
ductal carcinoma in situ -1.400 7.4e-04
Gaucher disease type 3 -1.700 2.8e-02
group 3 medulloblastoma -2.100 1.3e-05
intraductal papillary-mucinous carcinoma... -1.600 6.9e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.7e-02
invasive ductal carcinoma -1.800 5.6e-04
lung adenocarcinoma -1.200 4.9e-08
lung cancer -3.700 8.0e-04
malignant mesothelioma -3.000 1.0e-08
medulloblastoma, large-cell -3.500 4.6e-06
Multiple myeloma 1.009 3.5e-02
non-small cell lung cancer -1.639 2.4e-16
oligodendroglioma 1.200 6.9e-03
osteosarcoma -2.507 1.4e-03
ovarian cancer -4.000 2.9e-12
pancreatic cancer -1.100 1.8e-05
Pick disease 1.700 7.3e-06
pituitary cancer -3.000 2.8e-05
Polycystic ovary syndrome 1.402 3.5e-02
tuberculosis 1.800 2.4e-05

 GO Function (1)

 GO Process (1)

Gene RIF (1)

AA Sequence

MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSG      1 - 70
KLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDV     71 - 140
VVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWK    141 - 210
ALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK                                        211 - 244
//

Text Mined References (13)

PMID Year Title