Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.10
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
Multiple myeloma 1.009 0.035
malignant mesothelioma -3.000 0.000
oligodendroglioma 1.200 0.007
osteosarcoma -2.507 0.001
group 4 medulloblastoma -2.800 0.000
astrocytoma 1.400 0.019
atypical teratoid/rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -3.500 0.000
tuberculosis 1.800 0.000
non-small cell lung cancer -1.639 0.000
intraductal papillary-mucinous carcinoma... -1.600 0.007
intraductal papillary-mucinous neoplasm ... -1.200 0.027
colon cancer -3.200 0.001
lung cancer -5.500 0.000
ulcerative colitis -1.900 0.000
pancreatic cancer -1.100 0.000
breast carcinoma -1.300 0.000
cystic fibrosis -1.200 0.001
lung adenocarcinoma -2.700 0.000
non-inflammatory breast cancer -1.800 0.003
Polycystic Ovary Syndrome 1.402 0.035
Pick disease 1.700 0.000
ductal carcinoma in situ -1.400 0.001
invasive ductal carcinoma -1.800 0.001
ovarian cancer -4.000 0.000
Gaucher disease type 3 -1.700 0.028
pituitary cancer -3.000 0.000
Down syndrome 1.200 0.011
chronic rhinosinusitis -1.334 0.012

Synonym

Accession Q9H8H3 Q9H7R3 Q9UHZ7 Q9Y422
Symbols AAM-B

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
26185986 AAM-B is predominantly localized in lipid droplets and may be involved in recruitment of NS4B protein in the proximity of lipid droplets.

AA Sequence

MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSG      1 - 70
KLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDV     71 - 140
VVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWK    141 - 210
ALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK                                        211 - 244
//

Text Mined References (13)

PMID Year Title
26185986 2015 AAM-B Interacts with Nonstructural 4B and Regulates Hepatitis C Virus Propagation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19773358 2009 Targeting sequences of UBXD8 and AAM-B reveal that the ER has a direct role in the emergence and regression of lipid droplets.
18477614 2008 Identification of a novel N-terminal hydrophobic sequence that targets proteins to lipid droplets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...