Property Summary

NCBI Gene PubMed Count 13
PubMed Score 39.68
PubTator Score 16.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.400 1.2e-03
osteosarcoma -2.108 1.6e-06
ovarian cancer -1.300 1.8e-04
pancreatic ductal adenocarcinoma liver m... -1.064 1.9e-03

 GO Process (1)

 Compartment GO Term (2)

Gene RIF (3)

AA Sequence

MTGKKSSREKRRKRSSQEAAAALAAPDIVPALASGSSGSTSGCGSAGGCGSVSCCGNANFSGSVTGGGSG      1 - 70
GSCWGGSSVERSERRKRRSTDSSSVSGSLQQETKYILPTLEKELFLAEHSDLEEGGLDLTVSLKPVSFYI     71 - 140
SDKKEMLQQCFCIIGEKKLQKMLPDVLKNCSIEEIKKLCQEQLELLSEKKILKILEGDNGMDSDMEEEAD    141 - 210
DGSKMGSDLVSQQDICIDSASSVRENKQPEGLELKQGKGEDSDVLSINADAYDSDIEGPCNEEAAAPEAP    211 - 280
ENTVQSEAGQIDDLEKDIEKSVNEILGLAESSPNEPKAATLAVPPPEDVQPSAQQLELLELEMRARAIKA    281 - 350
LMKAGDIKKPA                                                               351 - 361
//

Text Mined References (25)

PMID Year Title