Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.200 4.9e-03
glioblastoma 1.100 1.5e-05
group 4 medulloblastoma 1.800 2.6e-04
malignant mesothelioma -2.700 1.4e-05
non primary Sjogren syndrome sicca -1.100 1.9e-02
osteosarcoma 1.923 1.0e-05
primitive neuroectodermal tumor 1.300 3.4e-03
spina bifida -2.178 2.9e-02

Gene RIF (1)

AA Sequence

MENLKSGVYPLKEASGCPGADRNLLVYSFYEKGPLTFRDVAIEFSLEEWQCLDTAQQDLYRKVMLENYRN      1 - 70
LVFLAGIAVSKPDLITCLEQGKEPWNMKRHAMVDQPPVTYSHFAQDLWPEQGIKDSFQEVILRRYGKCGH     71 - 140
EDLQLRTGCKSVDECNLHKECYDELNQCLTTTQSEIFQYDKYVNVFYKFSNPNIQKIRHTGKKPFKCKKC    141 - 210
DKSFCMLLHLTQHKRIHIRENSYQCEECGKVFNWFSTLTRHRRIHTGEKPYKCEQCGKAFKQSSTLTTHK    211 - 280
IIHTGEKPYRCEECGKTFNRSSHLTTHKRIHTGEKPYRCEECGRAFNRSSHLTTHKIIHTGEKPYKCEEC    281 - 350
GKAFNQSSTLTTHKIIHAGEKPYKCEECGKAFYRFSYLTKHKIIHTGEKFYKCEECGKGFNWSSTLTKHK    351 - 420
RIHTGEKPYKCEQCGKAFNESSNLTAHKIIHTGEKPYKCEECGKAFNRSPKLTAHKVIHSGEKPYKCEEC    421 - 490
GKAFNQFSNLTKHKITHIGDTSYKYLECDKAFSQSSTLTKHKVIHTGEKPYNCEEYGKAFNQSSNLIEQS    491 - 560
NSYWRETLQM                                                                561 - 570
//

Text Mined References (6)

PMID Year Title