Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.48
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 5.51592236313415E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 6.017806243547E-4
Disease Target Count Z-score Confidence
Anorexia nervosa 59 0.0 1.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.218 0.000
intraductal papillary-mucinous adenoma (... 1.500 0.001

Synonym

Accession Q9H8E8 A2A2I5 Q96GW6 Q96IH3 Q9HBF0 Q9UIY5 CSRP2-binding protein
Symbols ATAC2
CRP2BP
CSRP2BP
PRO1194
dJ717M23.1

Gene

  Ortholog (2)

Species Source
Mouse OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (1)

PMID Text
21079607 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MDSSIHLSSLISRHDDEATRTSTSEGLEEGEVEGETLLIVESEDQASVDLSHDQSGDSLNSDEGDVSWME      1 - 70
EQLSYFCDKCQKWIPASQLREQLSYLKGDNFFRFTCSDCSADGKEQYERLKLTWQQVVMLAMYNLSLEGS     71 - 140
GRQGYFRWKEDICAFIEKHWTFLLGNRKKTSTWWSTVAGCLSVGSPMYFRSGAQEFGEPGWWKLVHNKPP    141 - 210
TMKPEGEKLSASTLKIKAASKPTLDPIITVEGLRKRASRNPVESAMELKEKRSRTQEAKDIRRAQKEAAG    211 - 280
FLDRSTSSTPVKFISRGRRPDVILEKGEVIDFSSLSSSDRTPLTSPSPSPSLDFSAPGTPASHSATPSLL    281 - 350
SEADLIPDVMPPQALFHDDDEMEGDGVIDPGMEYVPPPAGSVASGPVVGVRKKVRGPEQIKQEVESEEEK    351 - 420
PDRMDIDSEDTDSNTSLQTRAREKRKPQLEKDTKPKEPRYTPVSIYEEKLLLKRLEACPGAVAMTPEARR    421 - 490
LKRKLIVRQAKRDRGLPLFDLDQVVNAALLLVDGIYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSL    491 - 560
PSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLHRSDPHW    561 - 630
TPEPDAPLDYCYVRPNHIPTINSMCQEFFWPGIDLSECLQYPDFSVVVLYKKVIIAFGFMVPDVKYNEAY    631 - 700
ISFLFVHPEWRRAGIATFMIYHLIQTCMGKDVTLHVSASNPAMLLYQKFGFKTEEYVLDFYDKYYPLEST    701 - 770
ECKHAFFLRLRR                                                              771 - 782
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19103755 2009 The double-histone-acetyltransferase complex ATAC is essential for mammalian development.
19060904 2009 An empirical framework for binary interactome mapping.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...